Autoblog http://www.autoblog.com Autoblog http://www.blogsmithmedia.com/www.autoblog.com/media/feedlogo.gif Autoblog http://www.autoblog.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[Infiniti queues up questionable Q and QX naming scheme]]>http://www.autoblog.com/2012/12/17/infiniti-queues-up-questionable-q-and-qx-naming-scheme/http://www.autoblog.com/2012/12/17/infiniti-queues-up-questionable-q-and-qx-naming-scheme/http://www.autoblog.com/2012/12/17/infiniti-queues-up-questionable-q-and-qx-naming-scheme/#commentsFiled under: , , , , , , , ,

2014 Infiniti Q naming scheme

Oh boy, this is about to get confusing with a capital Q.

Infiniti has just announced a brand-new scheme that calls for completely new model names across its entire lineup of vehicles. Making things even more difficult will be the fact that all coupes, convertible and sedans will get a Q prefix while all crossovers and SUVs will be prefixed with QX.

Further muddying the waters, previous engine displacement monikers will be replaced by a double-digit number "representing hierarchy within the range." Put less simply, the slot in the lineup currently held by the G Sedan will be called Q50 while the G Coupe and Convertible will be called Q60. Q70 will replace the M Sedan at the top of the automaker's lineup of cars.

On the truck side, the range-topping QX is now the QX80. Sitting below is the QX70, which was formerly the FX, then the QX60 that used to be the JX and finally the QX50, which was but is no longer the EX. Qonfused yet?

Getting back to the G... excuse us, Q50, this is the new sedan that Infiniti had previously announced would be debuting at the 2013 Detroit Auto Show. Best we can tell, this is a replacement for the old G Sedan, and it will sit below the currently available G Coupe and G Convertible, which will be renamed Q60.

The Q50 will be the first model from Infiniti to fall into the new Q-based naming convention, with the rest of the automaker's lineup falling into place as 2014 models are announced. Infiniti said on a conference call that this move was necessary as the brand branches out beyond the United States.

"This strategic change reflects Infiniti's desire for clarity and cohesiveness," says the press release, which you can read below. Hopefully, that will clear everything up for you...

Continue reading Infiniti queues up questionable Q and QX naming scheme

Infiniti queues up questionable Q and QX naming scheme originally appeared on Autoblog on Mon, 17 Dec 2012 19:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2012 detroit auto show2014 infiniti q50detroitdetroit 2012exfxgg37g37 convertibleg37 coupeinfinitijxmqq50q60q70qxqx50qx60qx70qx80Mon, 17 Dec 2012 19:00:00 EST http://www.autoblog.com/feed/20405457/article-comments.xml http://www.autoblog.com/feed/2012/12/17/infiniti-queues-up-questionable-q-and-qx-naming-scheme/20405457/article-detail.xml 20405457 http://www.blogcdn.com/www.autoblog.com/media/2012/12/q-infiniti-q_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/12/q-infiniti-q.jpg <![CDATA[Infiniti moving away from V8 power]]>http://www.autoblog.com/2012/09/05/infiniti-moving-away-from-v8-power/http://www.autoblog.com/2012/09/05/infiniti-moving-away-from-v8-power/http://www.autoblog.com/2012/09/05/infiniti-moving-away-from-v8-power/#commentsFiled under: , ,

Infiniti V8

According to Motoring.com.au, Infiniti will slowly be killing off its naturally aspirated V8 powerplants. The report comes after the Australian site spoke with Johan de Nysschen, Infiniti's global president, who stated that eight-cylinder engines are not in the product plans for any new vehicles currently on the drawing board.

"I am afraid (U.S.) CAFE regulations and emission regulations around the world make the development of V8s as part of a new family of engines almost impossible," reiterated Andy Palmer, executive vice president for Nissan. That said, Palmer later told the Australian site that having a V8 in its lineup does not dictate overall performance. "F1 has gone V6 for example. You can get the performance out of a V6 or an I4 and you can get the fuel consumption out of it." Moving forward, Infiniti will likely switch to boosted four- and six-cylinder powertrains that will offer comparable V8 performance with better overall fuel economy.

This certainly isn't a new trend in the automotive world. Many automakers are ditching V8 engines for more efficient V6 powerplants. Audi, for example, has replaced the vast majority of its 4.2-liter V8 engines with 3.0-liter supercharged V6 units in just the last couple of years. And on a larger scale, Ford is enjoying lots of success with its 3.5-liter twin-turbocharged V6 under the hood of its once V8-only F-150 pickup.

Here in the United States, Infiniti uses a 5.0-liter V8 under the hood of the FX50 and employs a larger 5.6-liter V8 in the M56 sedan and QX56 SUV. The report does not say if these V8-killing plans will also affect the Nissan lineup, which currently utilizes eight-cylinder engines in the Armada SUV, Titan pickup and NV commercial van.

Infiniti moving away from V8 power originally appeared on Autoblog on Wed, 05 Sep 2012 08:44:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>fxfx50infinitimm56qxqx56v8Wed, 05 Sep 2012 08:44:00 EST http://www.autoblog.com/feed/20315840/article-comments.xml http://www.autoblog.com/feed/2012/09/05/infiniti-moving-away-from-v8-power/20315840/article-detail.xml 20315840 http://www.blogcdn.com/www.autoblog.com/media/2012/09/17infinitimfd2011_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/09/17infinitimfd2011.jpg <![CDATA[BMW banking on carbon fiber costs to broaden M range]]>http://www.autoblog.com/2012/05/30/bmw-banking-on-carbon-fiber-costs-to-broaden-m-range/http://www.autoblog.com/2012/05/30/bmw-banking-on-carbon-fiber-costs-to-broaden-m-range/http://www.autoblog.com/2012/05/30/bmw-banking-on-carbon-fiber-costs-to-broaden-m-range/#commentsFiled under: , , , , , ,

BMW M Power

There once was a time when BMW only produced a handful of its models in high-performance M guise. There was the M3, the M5, and that was pretty much it. Now, however, it offers M models based on the 1 Series, 3 Series, 5 Series, 6 Series, X5 and X6. And that's only expected to grow.

The first on the docket, says BMW North America CEO (and former M chief) Ludwig Willisch speaking with TheDetroitBureau.com, will be an M7. The Bavarian automaker has long resisted going down the same road as the Mercedes-Benz S63 AMG and Audi S8, but that's slated to change in the near future. But while the X5 M and X6 M have been hot sellers, Willisch rules out the possibility of M versions of the smaller X1 and X3 crossovers, as well as bringing the M550d xDrive super-diesel-sport wagon (or presumably its crossover counterparts) to North America.

Of course, BMW could opt to apply a similar sub-M formula to the 7 Series like it's doing with the M135i. Either way, BMW is counting on the reduced cost and labor involved in manufacturing carbon fiber components for the viability of both its performance vehicles and its environmentally friendly i range.

As our compatriots at the Bureau note, the engineers at McLaren needed some 3,000 hours of labor to produce the carbon fiber components for the McLaren F1 over a decade ago. By the time it started building the SLR for Mercedes-Benz, it had cut that down to 400 hours. And with the new MP4-12C, it takes them less than six hours. As a result, costs have come down too, resulting in a lower street price for each successive model: $1 million, $400,000 and $250,000, respectively. And that's a model on which other automakers - like BMW - can seek to capitalize.

BMW banking on carbon fiber costs to broaden M range originally appeared on Autoblog on Wed, 30 May 2012 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bmwbmw mbmw m7carboncarbon fibermm7Wed, 30 May 2012 09:00:00 EST http://www.autoblog.com/feed/20244456/article-comments.xml http://www.autoblog.com/feed/2012/05/30/bmw-banking-on-carbon-fiber-costs-to-broaden-m-range/20244456/article-detail.xml 20244456 http://www.blogcdn.com/www.autoblog.com/media/2012/05/13-m-stillborns-live_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/05/13-m-stillborns-live.jpg <![CDATA[Pics Aplenty: BMW celebrates 40 years of M]]>http://www.autoblog.com/2012/05/16/pics-aplenty-bmw-celebrates-40-years-of-m/http://www.autoblog.com/2012/05/16/pics-aplenty-bmw-celebrates-40-years-of-m/http://www.autoblog.com/2012/05/16/pics-aplenty-bmw-celebrates-40-years-of-m/#commentsFiled under: , , ,

1978 BMW M1 - dead-on view, red

When we think of the BMW M division, the 1978 M1 comes instantly to mind, followed by the E30 M3 and then the 2001-2002 M Coupe. But the company's in-house hot rod shop actually dates back to 1972, when it was formed as a subsidiary to manage the company's racing operations, dubbed BMW Motorsport.

It was this month 40 years ago that what is known today as BMW M GmbH was launched. So to celebrate its anniversary, BMW has offloaded some 50 lustworthy images celebrating that performance history. See them all in our gallery.

Pics Aplenty: BMW celebrates 40 years of M originally appeared on Autoblog on Wed, 16 May 2012 19:29:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>1 m coupe1 series m coupebmwbmw mBMW Motorsportmm coupem roadsterm1m3m3 cslm5m6pics aplentyWed, 16 May 2012 19:29:00 EST http://www.autoblog.com/feed/20239585/article-comments.xml http://www.autoblog.com/feed/2012/05/16/pics-aplenty-bmw-celebrates-40-years-of-m/20239585/article-detail.xml 20239585 http://www.blogcdn.com/www.autoblog.com/media/2012/05/40-years-of-bmw-m-001-opt_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/05/40-years-of-bmw-m-001-opt.jpg <![CDATA[Infiniti recalling 2003-2004 M45 sedans over potential fuel gauge issue]]>http://www.autoblog.com/2012/03/13/infiniti-recalling-2003-2004-m45-sedans-over-potential-fuel-gaug/http://www.autoblog.com/2012/03/13/infiniti-recalling-2003-2004-m45-sedans-over-potential-fuel-gaug/http://www.autoblog.com/2012/03/13/infiniti-recalling-2003-2004-m45-sedans-over-potential-fuel-gaug/#commentsFiled under: , , , , ,



The National Highway Traffic Safety Administration began an investigation of the 2003 and 2004 Infiniti M45 late last year over inaccurate fuel gauge readings, and now that probe has resulted in an official recall. The culprit has been identified as a faulty circuit board that causes the gauge to register more fuel in the tank than the car actually has.

According to NHTSA, Infiniti will begin notifying owners in mid-April, at which time they can take their sport sedans to the dealer to be replaced free of charge. Follow the jump for the official word from NHTSA with more details.

Continue reading Infiniti recalling 2003-2004 M45 sedans over potential fuel gauge issue

Infiniti recalling 2003-2004 M45 sedans over potential fuel gauge issue originally appeared on Autoblog on Tue, 13 Mar 2012 13:59:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2003 infiniti m452004 infiniti m45infinitiinfiniti minfiniti recallmm45national highway traffic safety administrationnhtsarecallTue, 13 Mar 2012 13:59:00 EST http://www.autoblog.com/feed/20192151/article-comments.xml http://www.autoblog.com/feed/2012/03/13/infiniti-recalling-2003-2004-m45-sedans-over-potential-fuel-gaug/20192151/article-detail.xml 20192151 http://www.blogcdn.com/www.autoblog.com/media/2012/03/infinitim45recnh_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/03/infinitim45recnh.jpg <![CDATA[Nissan recalls Juke, Infiniti M and QX for possible fuel leaks]]>http://www.autoblog.com/2012/02/28/nissan-recalls-juke-infiniti-m-and-qx-for-possible-fuel-leaks/http://www.autoblog.com/2012/02/28/nissan-recalls-juke-infiniti-m-and-qx-for-possible-fuel-leaks/http://www.autoblog.com/2012/02/28/nissan-recalls-juke-infiniti-m-and-qx-for-possible-fuel-leaks/#commentsFiled under: , , , , , , ,




Nissan North America is recalling 2011 and 2012 Nissan Juke, Infiniti M and Infiniti QX models over a fuel pressure sensor issue. According to the National Highway Traffic Safety Administration, it's possible that the sensors weren't tightened properly, which could lead to the sensor coming loose over time and an increased risk of a fire due to leaking fuel.

The recall begins on March 19. Nissan will notify owners, who can take their vehicles to the dealer to be repaired free of charge. A bulletin from NHTSA that has more information is after the jump.

Continue reading Nissan recalls Juke, Infiniti M and QX for possible fuel leaks

Nissan recalls Juke, Infiniti M and QX for possible fuel leaks originally appeared on Autoblog on Tue, 28 Feb 2012 10:01:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>infiniti minfiniti qxjukemm37m56national highway traffic safety administrationnhtsanissan jukeqxqx56Tue, 28 Feb 2012 10:01:00 EST http://www.autoblog.com/feed/20181437/article-comments.xml http://www.autoblog.com/feed/2012/02/28/nissan-recalls-juke-infiniti-m-and-qx-for-possible-fuel-leaks/20181437/article-detail.xml 20181437 http://www.blogcdn.com/www.autoblog.com/media/2012/02/2011jukerecall_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/02/2011jukerecall.jpg <![CDATA[BMW goes blurry (again) in 1 Series M Performance parts teaser]]>http://www.autoblog.com/2012/02/15/bmw-goes-blurry-again-in-1-series-m-performance-parts-teaser/http://www.autoblog.com/2012/02/15/bmw-goes-blurry-again-in-1-series-m-performance-parts-teaser/http://www.autoblog.com/2012/02/15/bmw-goes-blurry-again-in-1-series-m-performance-parts-teaser/#commentsFiled under: , , ,



BMW apparently set a precedent when it teased its trio of M-fettled diesels. That video showed a speeding X6 with all the tell-tale bits of kit blurred out. Now, BMW is ready to give us a taste of its new 1 Series fitted with an assortment of M Performance baubles and it's taking a similar tact to tease us.

In the video after the jump you'll see the 2012 BMW 1 Series hatch running around the paddock and the track with all the "important" M stuff - fascias, mirrors, etc. - strategically blurred out.

Like the M diesels, we're hoping this is more than just an assortment of tacked-on body mods and more of a comprehensive, factory-approved upgrade path. We'll find out soon enough, as there's a solid change we'll see the M Performance 1 Series in Geneva next month.

Continue reading BMW goes blurry (again) in 1 Series M Performance parts teaser

BMW goes blurry (again) in 1 Series M Performance parts teaser originally appeared on Autoblog on Wed, 15 Feb 2012 19:32:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>1 seriesbmwbmw 1 seriesbmw 1 series m performancemm performancem performance partsWed, 15 Feb 2012 19:32:00 EST http://www.autoblog.com/feed/20172608/article-comments.xml http://www.autoblog.com/feed/2012/02/15/bmw-goes-blurry-again-in-1-series-m-performance-parts-teaser/20172608/article-detail.xml 20172608 http://www.blogcdn.com/www.autoblog.com/media/2012/02/m-per-1-series-vid-cap_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/02/m-per-1-series-vid-cap.jpg <![CDATA[BMW M shows off new diesel-powered lineup in motion]]>http://www.autoblog.com/2012/01/26/bmw-m-shows-off-new-diesel-powered-lineup-in-motion/http://www.autoblog.com/2012/01/26/bmw-m-shows-off-new-diesel-powered-lineup-in-motion/http://www.autoblog.com/2012/01/26/bmw-m-shows-off-new-diesel-powered-lineup-in-motion/#commentsFiled under: , , , , , ,



If you'd like to see more of BMW newly unveiled range of M Diesels, here's your chance. To recap, BMW revealed four tri-turboed, diesel-engined, all-wheel-drive M cars for European buyers yesterday: the M550d xDrive (a.k.a. 5 Series) sedan and touring, the X5 M50d and the X6 M50d. All use a 3.0-liter inline-six putting out 376 horses and 545 through an eight-speed auto, and in the case of the M550d sedan it can get to 60 mph in 4.6 seconds.

That makes each of the white knights in the promo piece both sporty and powerful, as you'll hear often in the video after the jump.

Continue reading BMW M shows off new diesel-powered lineup in motion

BMW M shows off new diesel-powered lineup in motion originally appeared on Autoblog on Thu, 26 Jan 2012 18:58:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>5 seriesbmwbmw mbmw m dieselbmw m550dbmw m550d touringbmw x5 m50dbmw x6 m50ddieselmm dieseltri-turbovideox5x6Thu, 26 Jan 2012 18:58:00 EST http://www.autoblog.com/feed/20157098/article-comments.xml http://www.autoblog.com/feed/2012/01/26/bmw-m-shows-off-new-diesel-powered-lineup-in-motion/20157098/article-detail.xml 20157098 http://www.blogcdn.com/www.autoblog.com/media/2012/01/bmwmdieselsvid_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/01/bmwmdieselsvid.jpg <![CDATA[BMW M goes diesel, introduces M550d, X5 M50d, X6 M50d]]>http://www.autoblog.com/2012/01/25/bmw-m-goes-diesel-introduces-m550d-x5-m50d-x6-m50d/http://www.autoblog.com/2012/01/25/bmw-m-goes-diesel-introduces-m550d-x5-m50d-x6-m50d/http://www.autoblog.com/2012/01/25/bmw-m-goes-diesel-introduces-m550d-x5-m50d-x6-m50d/#commentsFiled under: , , , , , , ,



Rumors of BMW M launching a diesel model have been circulating for over a year, and confirmation has finally arrived in the form of not one, not two, but four M-fettled oil-burners, each sporting all-wheel drive and the oft-rumored tri-turbocharged 3.0-liter inline six. And before you get excited, none of them are slated for sale in the U.S. - this is a Euro-only affair.

So with that unfortunate fact out of the way, let's get to the details.

The new M models come in the form of the M550d xDrive sedan, M550d xDrive touring, X5 M50d and X6 M50d. Each makes use of a 3.0-liter inline-six common-rail diesel with the aforementioned trio of turbos specifically developed for the M Performance range. Output is rated at 376 horsepower at 4,000 rpm and 545 pound-feet of torque available from 2,000 to 3,000 revs. If you're keeping track at home, that's a bump of 80 hp and 103 lb-ft over the 535d and 74 hp and 103 lb-ft more than the 3.0-liter mill fitted to the diesel X5 and X6.

Each model comes equipped with an eight-speed automatic gearbox and standard xDrive AWD, allowing the M550d sedan to hit 60 mph in 4.6 seconds - just four tenths of a second off the all-new M5's 0-60 run. You read that right. The M550d Touring hits 60 in 4.9 seconds, with the X5 M50d and X6 M50d passing the mark in 5.4 and 5.3 seconds, respectively. All models are limited to 155 mph and fuel consumption ranges between 6.4 liters/100km and 7.7 liters/100km.

Interestingly, the M-ified diesel 5ers ditch the standard electromechanical steering for a hydraulic system that's derived from the M5, and both the X5 and X6 variants uses systems similar to those on the X5 M and X6 M.

And if you're wondering why we won't see these M diesels here in the States, blame the necessity to reengineer the SCR (selective catalytic reduction) systems to make them comply with emissions standards across the country. We'll be seeing all four live from the Geneva Motor Show in March, but you can get the first batch of details in the press release after the break.

Continue reading BMW M goes diesel, introduces M550d, X5 M50d, X6 M50d

BMW M goes diesel, introduces M550d, X5 M50d, X6 M50d originally appeared on Autoblog on Wed, 25 Jan 2012 19:27:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>5 seriesbmwbmw mbmw m550dbmw m550d touringbmw x5 m50dbmw x6 m50ddieselmm dieselx5x6Wed, 25 Jan 2012 19:27:00 EST http://www.autoblog.com/feed/20156972/article-comments.xml http://www.autoblog.com/feed/2012/01/25/bmw-m-goes-diesel-introduces-m550d-x5-m50d-x6-m50d/20156972/article-detail.xml 20156972 http://www.blogcdn.com/www.autoblog.com/media/2012/01/02-m-performance-diesels-628_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/01/02-m-performance-diesels-628.jpg <![CDATA[Followup: Infiniti M35h is world's "fastest" hybrid]]>http://www.autoblog.com/2012/01/24/followup-infiniti-m35h-is-worlds-fastest-hybrid/http://www.autoblog.com/2012/01/24/followup-infiniti-m35h-is-worlds-fastest-hybrid/http://www.autoblog.com/2012/01/24/followup-infiniti-m35h-is-worlds-fastest-hybrid/#commentsFiled under: , , , , , , ,

Infiniti M35h versus Porsche Panamera S Hybrid

We don't imagine that many new-car buyers are cross-shopping their local Infiniti and Porsche dealerships, but there's at least one segment of the automotive industry where the two automakers both play ball: high-performance hybrid luxury sedans, which may be the single most conflicted niche of the automotive sphere in the known universe.

In any case, here we are with the Infiniti M35h and Porsche Panamera S Hybrid. Each one is marketed as both a somewhat greener luxury vehicle and a performance sedan. We'd guess it's the performance side of the equation that would be most interesting to the majority of buyers, leaving fuel efficiency a welcome bonus.

So, which one is faster? That's an interesting question. Usually, we equate that term with top speed, as "fast" connotes velocity. When acceleration is being contested, we generally ask which machine is quickest. And, if it's quickness you're after, Infiniti wants you to know that its M35h will out-accelerate its competitor from Germany. How quick is it? According to Motor Trend, the hybrid M goes from 0-60 in 5.1 seconds, but that's not the stat Infiniti is claiming. According to the post-jump press release, the M35h is "faster" than the hybrid Panamera from 0-100 (11.54 seconds) and in the quarter mile (13.41 seconds).

As for the rest of the relevant statistics, the EPA estimates that the M35h will manage 27 miles per gallon in the city and 32 on the highway, for a combined rating of 29. The Porsche Panamera S Hybrid is rated at 22 city, 30 highway and 25 combined. Seems the M hybrid takes both the acceleration and economy awards. Check out a video released by Infiniti after the break, where you'll also find the press release, if you're into that kind of thing.

Continue reading Followup: Infiniti M35h is world's "fastest" hybrid

Followup: Infiniti M35h is world's "fastest" hybrid originally appeared on Autoblog on Tue, 24 Jan 2012 16:56:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>fastest hybridinfinitiinfiniti mmm hybridm35m35hpanamerapanamera s hybridporschequickest hybridvideoTue, 24 Jan 2012 16:56:00 EST http://www.autoblog.com/feed/20155579/article-comments.xml http://www.autoblog.com/feed/2012/01/24/followup-infiniti-m35h-is-worlds-fastest-hybrid/20155579/article-detail.xml 20155579 http://www.blogcdn.com/www.autoblog.com/media/2012/01/infiniti-m35h-porsche-panamera-hybrid_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/01/infiniti-m35h-porsche-panamera-hybrid.jpg <![CDATA[BMW M5 quicker than 1 M Coupe quicker than M3]]>http://www.autoblog.com/2011/12/29/bmw-m5-quicker-than-1-m-coupe-quicker-than-m3/http://www.autoblog.com/2011/12/29/bmw-m5-quicker-than-1-m-coupe-quicker-than-m3/http://www.autoblog.com/2011/12/29/bmw-m5-quicker-than-1-m-coupe-quicker-than-m3/#commentsFiled under: , , , , , ,

2012 BMW M5 front three-quarter

Autobild recently set out to settle the question of which M vehicle is the fastest in the BMW stable at the moment. Not surprisingly, the German enthusiast publication found the BMW M3 CRT to be the quickest around the Sachsenring, setting the magazine's fastest time around the track with a 1:38.37 minute lap time. That's impressive, but not nearly as astounding as the time drummed up by the new BMW M5. The portly sedan did the same deed in 1:38.90, or just three hundredths of a second slower than the special-edition M3.

And what of the sibling rivalry between the BMW 1 Series M Coupe and the standard M3? As it turns out, the magazine's shoes have given the nod to the smaller of the two coupes. The 1 Series M Coupe barely eked out a win over the M3, though the M3 Convertible took nearly two extra seconds to make it around the course than its hardtop twin.

BMW M5 quicker than 1 M Coupe quicker than M3 originally appeared on Autoblog on Thu, 29 Dec 2011 11:01:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>1 m coupe1 series1 series m1 series m coupe1m coupeautobildbmw 1 series m coupebmw mbmw m3bmw m5mm1m3m5Thu, 29 Dec 2011 11:01:00 EST http://www.autoblog.com/feed/20136715/article-comments.xml http://www.autoblog.com/feed/2011/12/29/bmw-m5-quicker-than-1-m-coupe-quicker-than-m3/20136715/article-detail.xml 20136715 http://www.blogcdn.com/www.autoblog.com/media/2011/09/2012-bmw-m5-fd_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/09/2012-bmw-m5-fd.jpg <![CDATA[Nissan initiates multi-vehicle recall over faulty bolts]]>http://www.autoblog.com/2011/12/24/nissan-initiates-multi-vehicle-recall-over-faulty-bolts/http://www.autoblog.com/2011/12/24/nissan-initiates-multi-vehicle-recall-over-faulty-bolts/http://www.autoblog.com/2011/12/24/nissan-initiates-multi-vehicle-recall-over-faulty-bolts/#commentsFiled under: , , , , , , , ,



Nissan is recalling just over 14,700 vehicles from the 2011 and 2012 model years over faulty bolts in the engine. According to the National Highway Traffic Safety Administration, "bolts that connect the engine oil cooler and the engine oil filter to the engine in these vehicles may have been manufactured to below specification strength."

Affected Nissan vehicles include the 2011-12 Pathfinder, 2011-12 Xterra, 2012 NV and 2012 Frontier. Additionally, the 2011 Infiniti FX and 2012 Infiniti M are being recalled for this issue.

The NHTSA report states that if there is an engine oil leak, pressure would drop and the engine could possibly seize. Bad news all around.

The recall is expected to kick off in mid-January, and Nissan dealers will replace the connector bolts free of charge. To read the full NHTSA report, follow the jump.

Continue reading Nissan initiates multi-vehicle recall over faulty bolts

Nissan initiates multi-vehicle recall over faulty bolts originally appeared on Autoblog on Sat, 24 Dec 2011 17:02:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>frontierfxinfinitimnissannvpathfinderrecallsafetyxterraSat, 24 Dec 2011 17:02:00 EST http://www.autoblog.com/feed/20134101/article-comments.xml http://www.autoblog.com/feed/2011/12/24/nissan-initiates-multi-vehicle-recall-over-faulty-bolts/20134101/article-detail.xml 20134101 http://www.blogcdn.com/www.autoblog.com/media/2011/12/01-nissan-infiniti-recall628_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/12/01-nissan-infiniti-recall628.jpg <![CDATA[Autoblog Podcast #260]]>http://www.autoblog.com/2011/12/13/autoblog-podcast-260-dodge-dart-scion-fr-s-bmw-ilx-6-series/http://www.autoblog.com/2011/12/13/autoblog-podcast-260-dodge-dart-scion-fr-s-bmw-ilx-6-series/http://www.autoblog.com/2011/12/13/autoblog-podcast-260-dodge-dart-scion-fr-s-bmw-ilx-6-series/#commentsFiled under: , , , , , , , , ,

Dodge Dart teased, Scion FR-S First Drive, Fiat 500 crash test, Acura NSX and ILX, BMW 6 Series Gran Coupe

autoblog podcast

Episode #260 of the Autoblog Podcast is here with Chris, Dan, Chris Paukert and Zach this week. Topics include the teaser images Chrysler has released of the 2012 Dodge Dart, our first drive of the Scion FR-S, the Fiat 500 crash test aftermath, A new Acura NSX and ILX, and the BMW 6 Series Gran Coupe. Your questions and comments power the end of the 'cast, and for those of you who hung with us live on our UStream channel, thanks for taking the time. We've embedded our Q&A module after the jump for you to scroll through and follow along, too. Thanks for listening!

Autoblog Podcast #260:
In the Autoblog Garage
2011 Chevrolet Silverado 1500 LTZ Crew Cab
2012 Land Rover Evoque
2012 Buick Regal eAssist
2012 Infiniti M37

Hosts: Dan Roth, Chris Shunk, Zach Bowman, Chris Paukert
Runtime: 01:27:53
Get the podcast
[UStream] Listen live on Mondays at 10PM Eastern at UStream
[iTunes] Subscribe to the Autoblog Podcast in iTunes
[RSS] Add the Autoblog Podcast feed to your RSS aggregator
[MP3] Download the MP3 directly

Feedback
Email: Podcast at Autoblog dot com
Voicemail: 734-288-8POD (734-288-8763)

Review the show in iTunes and take our survey

Continue reading Autoblog Podcast #260

Autoblog Podcast #260 originally appeared on Autoblog on Tue, 13 Dec 2011 14:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>5006 series6 series gran coupeacura ilxacura nsxautoblog podcastdartevoquefeaturedfr-silxmm37nsxregalscion fr-ssilveradoTue, 13 Dec 2011 14:15:00 ESTAutoblog Podcast #260Autoblog01:27:53 http://www.autoblog.com/feed/20127054/article-comments.xml http://www.autoblog.com/feed/2011/12/13/autoblog-podcast-260-dodge-dart-scion-fr-s-bmw-ilx-6-series/20127054/article-detail.xml 20127054 http://www.blogcdn.com/www.autoblog.com/media/2011/06/podcastlivev2stamp_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/06/podcastlivev2stamp.jpg <![CDATA[<i>Ward's</i> releases annual 10 Best Engines list]]>http://www.autoblog.com/2011/12/08/wards-releases-annual-10-best-engines-list/http://www.autoblog.com/2011/12/08/wards-releases-annual-10-best-engines-list/http://www.autoblog.com/2011/12/08/wards-releases-annual-10-best-engines-list/#commentsFiled under: , , , , , , , , , , , ,

2012 Ford Mustang Boss 302 engine

It's that time of year, folks. No, we're not referring to the oodles of time spent shopping for the holidays, we're talking about end-of-the-year lists. Kicking things off in the automotive spectrum is industry stalwart Ward's Auto, which has just released its annual 10 Best Engines list.

Without further ado, here are the award-winners for 2012:
It comes as little surprise that seven of the ten engines on the list feature the most recent advance in power and efficiency, namely direct injection, or that a full half of them are boosted with the addition of either a supercharger or a turbocharger. Perhaps more surprising is that there's only one hybrid powertrain on the list, and it's from Infiniti, not Toyota or Lexus.

In fact, there isn't a single engine from Honda or Toyota on 2011's edition of the 10 Best Engines, nor are the 1.4-liter/111kW electric motor package in the Chevrolet Volt or 80kW AC motor in the Nissan Leaf anywhere to be found - both of which were on the list in 2010. Also missing? A diesel... any diesel - and there certainly are a few options from the likes of Audi, BMW, Mercedes-Benz and Volkswagen from which to choose.

Though its neither direct-injected nor turbocharged, the Pentastar V6 from Chrysler is surely worthy of inclusion, if for no other reason than its single-handed ability to transform any vehicle it's in from an also-ran to a competitive proposition.

We'll also give a shout-out to Ford, which earned two spots on the list but could seemingly have garnered another for the excellent 3.5-liter EcoBoost engine in the F-150 pickup. Ward's has plenty of commentary on why each engine was chosen, and you can read all about it right here. But first, have a look at each powerplant in our high-res image gallery.

Ward's releases annual 10 Best Engines list originally appeared on Autoblog on Thu, 08 Dec 2011 13:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>10 best engines3 series3005 seriesa6accentdirect injectionecoboostedgeenginemm35hmazda3mustangmustang boss 302pentastarregalsoulwardswards 10 best engineswards autowranglerz4Thu, 08 Dec 2011 13:30:00 EST http://www.autoblog.com/feed/20123767/article-comments.xml http://www.autoblog.com/feed/2011/12/08/wards-releases-annual-10-best-engines-list/20123767/article-detail.xml 20123767 http://www.blogcdn.com/www.autoblog.com/media/2011/12/2012-ford-mustang-boss-302-engine_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/12/2012-ford-mustang-boss-302-engine.jpg <![CDATA[The BMW M table is too good for coffee]]>http://www.autoblog.com/2011/11/29/the-bmw-m-table-is-too-good-for-coffee/http://www.autoblog.com/2011/11/29/the-bmw-m-table-is-too-good-for-coffee/http://www.autoblog.com/2011/11/29/the-bmw-m-table-is-too-good-for-coffee/#commentsFiled under: ,



We aren't typically ones to geek out on furniture, but this warrants an exception to the rule. Phillips Collection has worked up a coffee table perfect for any BMW fan. From the side, the piece simply looks to be three tilted boxes, but view the table from above and it becomes clear that it's actually a physical manifestation of the BMW M logo. Made from cold-pressed steel and powder coated in the exact hues used by the BMW go-fast division, the table is sure to last for years and years. If you want one as badly as we do, you'll have to contact Phillips Collection for more information.

Designer Jason Phillips is based in Greensboro, North Carolina and has crafted a number of innovative tables and chairs. You can check out his full portfolio by heading over to his Behance page.

The BMW M table is too good for coffee originally appeared on Autoblog on Tue, 29 Nov 2011 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bmwbmw mbmw m tablebmw tablemm tablephillips collectionTue, 29 Nov 2011 15:30:00 EST http://www.autoblog.com/feed/20116482/article-comments.xml http://www.autoblog.com/feed/2011/11/29/the-bmw-m-table-is-too-good-for-coffee/20116482/article-detail.xml 20116482 http://www.blogcdn.com/www.autoblog.com/media/2011/11/m-table-opt_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/11/m-table-opt.jpg <![CDATA[Nissan, Mitsubishi confirm plans to share Fuga sedan]]>http://www.autoblog.com/2011/09/23/nissan-mitsubishi-confirm-plans-to-share-fuga-sedan/http://www.autoblog.com/2011/09/23/nissan-mitsubishi-confirm-plans-to-share-fuga-sedan/http://www.autoblog.com/2011/09/23/nissan-mitsubishi-confirm-plans-to-share-fuga-sedan/#commentsFiled under: , , , ,

Earlier this week, reports out of Japan stated that Nissan would be lending a version of its Fuga sedan to Mitsubishi. The Fuga, better known in the United States as the Infiniti M, would serve as Mitsubishi's new flagship sedan in the Japanese market. Now, the two automakers have released a statement confirming plans for Nissan to supply the Fuga to Mitsubishi, beginning in the summer of 2012. At this time, it is still unclear whether or not we'll see a Mitsubishi-baged Fuga here in the U.S. Hit the jump for the official release.

Continue reading Nissan, Mitsubishi confirm plans to share Fuga sedan

Nissan, Mitsubishi confirm plans to share Fuga sedan originally appeared on Autoblog on Fri, 23 Sep 2011 16:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>fugainfinitimmitsubishinissansedanFri, 23 Sep 2011 16:15:00 EST http://www.autoblog.com/feed/20051030/article-comments.xml http://www.autoblog.com/feed/2011/09/23/nissan-mitsubishi-confirm-plans-to-share-fuga-sedan/20051030/article-detail.xml 20051030 http://www.blogcdn.com/www.autoblog.com/media/2011/09/02-nissan-fuga-hybrid-press-1316806323_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/09/02-nissan-fuga-hybrid-press-1316806323.jpg <![CDATA[Mitsubishi to borrow Diamante successor from Nissan]]>http://www.autoblog.com/2011/09/22/mitsubishi-to-borrow-diamante-successor-from-nissan/http://www.autoblog.com/2011/09/22/mitsubishi-to-borrow-diamante-successor-from-nissan/http://www.autoblog.com/2011/09/22/mitsubishi-to-borrow-diamante-successor-from-nissan/#commentsFiled under: , , , ,

Nissan Fuga

Mitsubishi owners and car enthusiasts may recall a model called the Diamante. It was the Japanese automaker's flagship luxury sedan until it was discontinued in 2004. But now the time appears ripe to bring it back - in the Japanese domestic market, at least.

Rather than develop its own model, however, reports confirm earlier rumors indicating that Mitsubishi will rebadge a version of the Fuga produced by Nissan - a model better known to North American buyers as the Infiniti M. Nissan offers the Fuga/M with V6, V8, hybrid and diesel powertrains. It remains to be seen, however, which engines will find their way under the hood of the Mitsubishi version.

The arrangement is only the latest development in an ongoing partnership between Mitsubishi and Nissan that also includes a rebadged version of the Nissan NV200 Vanette, along with other models. However these exercises in badge engineering aren't expected, for the time being at least, to make it to the North American market.

Mitsubishi to borrow Diamante successor from Nissan originally appeared on Autoblog on Thu, 22 Sep 2011 13:02:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>diamantefugainfinitiinfiniti mjdmmmitsubishimitsubishi diamantenissannissan fugaThu, 22 Sep 2011 13:02:00 EST http://www.autoblog.com/feed/20049728/article-comments.xml http://www.autoblog.com/feed/2011/09/22/mitsubishi-to-borrow-diamante-successor-from-nissan/20049728/article-detail.xml 20049728 http://www.blogcdn.com/www.autoblog.com/media/2011/09/02-nissan-fuga-hybrid-press_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/09/02-nissan-fuga-hybrid-press.jpg <![CDATA[<i>Autocar</i> pits BMW 1 Series M Coupe against Porsche Cayman R]]>http://www.autoblog.com/2011/05/30/autocar-pits-bmw-1-series-m-coupe-against-porsche-cayman/http://www.autoblog.com/2011/05/30/autocar-pits-bmw-1-series-m-coupe-against-porsche-cayman/http://www.autoblog.com/2011/05/30/autocar-pits-bmw-1-series-m-coupe-against-porsche-cayman/#commentsFiled under: , , , , ,

2011 BMW 1M Coupe vs. 2011 Porsche Cayman R
2011 BMW 1 Series M Coupe vs. 2011 Porsche Cayman R - Click above to view video after the jump

The 2011 BMW 1 Series M Coupe has been setting hearts on fire across the automotive press since Munich started teasing the car a couple years ago. Now that it has finally arrived, Autocar decided to see if it lived up to its own hype when faced with the lithe 2011 Porsche Cayman R.

We'll save giving away the outcome of the comparison in the video, but suffice it to say the 1M Coupe satisfies expectations. It brings back the raw, visceral driving experience characteristic of the old M cars and is relatively affordable. All things we dig. With that knowledge safely in hand, click past the jump to see how the little M rocket stacks up to the competition.

Continue reading Autocar pits BMW 1 Series M Coupe against Porsche Cayman R

Autocar pits BMW 1 Series M Coupe against Porsche Cayman R originally appeared on Autoblog on Mon, 30 May 2011 20:02:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>1 series1 series m coupe2011 bmw 1 series m coupe2011 porsche cayman rbmwcayman rmporscheMon, 30 May 2011 20:02:00 EST http://www.autoblog.com/feed/19953546/article-comments.xml http://www.autoblog.com/feed/2011/05/30/autocar-pits-bmw-1-series-m-coupe-against-porsche-cayman/19953546/article-detail.xml 19953546 http://www.blogcdn.com/www.autoblog.com/media/2011/05/1m-vs-caymanr-lead_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/05/1m-vs-caymanr-lead.jpg <![CDATA[2012 Infiniti M35h]]>http://www.autoblog.com/2011/04/26/2012-infiniti-m35h-quick-spin-review-road-test/http://www.autoblog.com/2011/04/26/2012-infiniti-m35h-quick-spin-review-road-test/http://www.autoblog.com/2011/04/26/2012-infiniti-m35h-quick-spin-review-road-test/#commentsFiled under: , , , ,

Appealing To Both The Fast And Frugal

2012 Infiniti M35h
2012 Infiniti M35h - Click above for high-res image gallery

It is time for enthusiasts to embrace hybrid powertrain technology. A few short years ago, the mention of "hybrid power" conjured up images of low displacement engines, tiny electric boost motors and lethargic performance. Sure, the vehicles were environmentally-friendly (on a local level, at least) and they spanked their pure-combustion counterparts when it came to fueling stops, but they were also absolutely boring to drive. No, make that numbing.

Of course, there are always a few exceptions to the rule. Vehicles including the Lexus LS 600h L, Lexus GS 450h, BMW ActiveHybrid 750i and BMW ActiveHybrid X6 deliver spirited performance, but only mediocre improvements over their gas-only siblings when it comes to efficiency. And, we don't need to remind you that these vehicles are always very complex, excessively heavy and hardly inexpensive - there were simply few compelling reasons to put one in the garage.

Infiniti, a brand in itself almost embarrassing late to the hybrid game, seems to be in a position to change all that.

Continue reading Quick Spin: 2012 Infiniti M35h...


Gallery: 2012 Infiniti M35h: Quick Spin

2012 Infiniti M35h2012 Infiniti M35h2012 Infiniti M35h2012 Infiniti M35h2012 Infiniti M35h

Photos copyright (C)2011 Chris Shunk / AOL

Continue reading 2012 Infiniti M35h

2012 Infiniti M35h originally appeared on Autoblog on Tue, 26 Apr 2011 11:58:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2012 infiniti m35hfeaturedinfinitiinfiniti mmm35hquick spinquickspinTue, 26 Apr 2011 11:58:00 EST http://www.autoblog.com/feed/19885599/article-comments.xml http://www.autoblog.com/feed/2011/04/26/2012-infiniti-m35h-quick-spin-review-road-test/19885599/article-detail.xml 19885599 http://www.blogcdn.com/www.autoblog.com/media/2011/04/03-2012-infiniti-m35h-qs-opt_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/04/03-2012-infiniti-m35h-qs-opt.jpg <![CDATA[Leaked? 2012 BMW 6 Series M-Sport package rears its sporty head]]>http://www.autoblog.com/2011/04/21/leaked-2012-bmw-6-series-m-sport-package-rears-its-sporty-head/http://www.autoblog.com/2011/04/21/leaked-2012-bmw-6-series-m-sport-package-rears-its-sporty-head/http://www.autoblog.com/2011/04/21/leaked-2012-bmw-6-series-m-sport-package-rears-its-sporty-head/#commentsFiled under: , , , ,

BMW 6 Series M Sport Package leak

When BMW unveils a new sports coupe, it's an exciting development. If not in its own right, then because you know it's going to lead to a new M model. And so the new 6 Series will lead to a new M6, but not just yet.

That's where the M-Sport package comes in. Though the trim pack for the new 6 Series has yet to be released, this solitary (grainy) image has apparently leaked out via an ad in a Dutch newspaper.

As with other models, this new M-Sport pack serves a dual purpose. Ostensibly it gives buyers of the standard model a little extra in the cosmetic department for a sportier look. But it may also give us a little heads-up on how the full-on M6 will look whenever it's finally released. So take a good long look at the bigger wheels and the new front bumper with integrated LED running lights, and bide your time until the new M6 comes along.

[Source: 6post.com via TopSpeed]

Leaked? 2012 BMW 6 Series M-Sport package rears its sporty head originally appeared on Autoblog on Thu, 21 Apr 2011 09:20:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>2012 bmw 6 series2012 bmw 6 series coupe6 series6-seriesbmwbmw 6 seriesbmw 6 series coupebmw mmm-sportm-sport packagem6Thu, 21 Apr 2011 09:20:00 EST http://www.autoblog.com/feed/19918862/article-comments.xml http://www.autoblog.com/feed/2011/04/21/leaked-2012-bmw-6-series-m-sport-package-rears-its-sporty-head/19918862/article-detail.xml 19918862 http://www.blogcdn.com/www.autoblog.com/media/2011/04/bmw-6-series-m-sport_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/04/bmw-6-series-m-sport.jpg -1 2