Autoblog http://www.autoblog.com Autoblog http://www.blogsmithmedia.com/www.autoblog.com/media/feedlogo.gif Autoblog http://www.autoblog.com en-us Copyright 2012 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[BMW M shows off new diesel-powered lineup in motion]]>http://www.autoblog.com/2012/01/26/bmw-m-shows-off-new-diesel-powered-lineup-in-motion/http://www.autoblog.com/2012/01/26/bmw-m-shows-off-new-diesel-powered-lineup-in-motion/http://www.autoblog.com/2012/01/26/bmw-m-shows-off-new-diesel-powered-lineup-in-motion/#commentsFiled under: , , , , , ,



If you'd like to see more of BMW newly unveiled range of M Diesels, here's your chance. To recap, BMW revealed four tri-turboed, diesel-engined, all-wheel-drive M cars for European buyers yesterday: the M550d xDrive (a.k.a. 5 Series) sedan and touring, the X5 M50d and the X6 M50d. All use a 3.0-liter inline-six putting out 376 horses and 545 through an eight-speed auto, and in the case of the M550d sedan it can get to 60 mph in 4.6 seconds.

That makes each of the white knights in the promo piece both sporty and powerful, as you'll hear often in the video after the jump.

Continue reading BMW M shows off new diesel-powered lineup in motion

BMW M shows off new diesel-powered lineup in motion originally appeared on Autoblog on Thu, 26 Jan 2012 18:58:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>5 seriesbmwbmw mbmw m dieselbmw m550dbmw m550d touringbmw x5 m50dbmw x6 m50ddieselmm dieseltri-turbovideox5x6Thu, 26 Jan 2012 18:58:00 EST http://www.autoblog.com/feed/20157098/article-comments.xml http://www.autoblog.com/feed/2012/01/26/bmw-m-shows-off-new-diesel-powered-lineup-in-motion/20157098/article-detail.xml 20157098 http://www.blogcdn.com/www.autoblog.com/media/2012/01/bmwmdieselsvid_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/01/bmwmdieselsvid.jpg <![CDATA[BMW M goes diesel, introduces M550d, X5 M50d, X6 M50d]]>http://www.autoblog.com/2012/01/25/bmw-m-goes-diesel-introduces-m550d-x5-m50d-x6-m50d/http://www.autoblog.com/2012/01/25/bmw-m-goes-diesel-introduces-m550d-x5-m50d-x6-m50d/http://www.autoblog.com/2012/01/25/bmw-m-goes-diesel-introduces-m550d-x5-m50d-x6-m50d/#commentsFiled under: , , , , , , ,



Rumors of BMW M launching a diesel model have been circulating for over a year, and confirmation has finally arrived in the form of not one, not two, but four M-fettled oil-burners, each sporting all-wheel drive and the oft-rumored tri-turbocharged 3.0-liter inline six. And before you get excited, none of them are slated for sale in the U.S. - this is a Euro-only affair.

So with that unfortunate fact out of the way, let's get to the details.

The new M models come in the form of the M550d xDrive sedan, M550d xDrive touring, X5 M50d and X6 M50d. Each makes use of a 3.0-liter inline-six common-rail diesel with the aforementioned trio of turbos specifically developed for the M Performance range. Output is rated at 376 horsepower at 4,000 rpm and 545 pound-feet of torque available from 2,000 to 3,000 revs. If you're keeping track at home, that's a bump of 80 hp and 103 lb-ft over the 535d and 74 hp and 103 lb-ft more than the 3.0-liter mill fitted to the diesel X5 and X6.

Each model comes equipped with an eight-speed automatic gearbox and standard xDrive AWD, allowing the M550d sedan to hit 60 mph in 4.6 seconds - just four tenths of a second off the all-new M5's 0-60 run. You read that right. The M550d Touring hits 60 in 4.9 seconds, with the X5 M50d and X6 M50d passing the mark in 5.4 and 5.3 seconds, respectively. All models are limited to 155 mph and fuel consumption ranges between 6.4 liters/100km and 7.7 liters/100km.

Interestingly, the M-ified diesel 5ers ditch the standard electromechanical steering for a hydraulic system that's derived from the M5, and both the X5 and X6 variants uses systems similar to those on the X5 M and X6 M.

And if you're wondering why we won't see these M diesels here in the States, blame the necessity to reengineer the SCR (selective catalytic reduction) systems to make them comply with emissions standards across the country. We'll be seeing all four live from the Geneva Motor Show in March, but you can get the first batch of details in the press release after the break.

Continue reading BMW M goes diesel, introduces M550d, X5 M50d, X6 M50d

BMW M goes diesel, introduces M550d, X5 M50d, X6 M50d originally appeared on Autoblog on Wed, 25 Jan 2012 19:27:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>5 seriesbmwbmw mbmw m550dbmw m550d touringbmw x5 m50dbmw x6 m50ddieselmm dieselx5x6Wed, 25 Jan 2012 19:27:00 EST http://www.autoblog.com/feed/20156972/article-comments.xml http://www.autoblog.com/feed/2012/01/25/bmw-m-goes-diesel-introduces-m550d-x5-m50d-x6-m50d/20156972/article-detail.xml 20156972 http://www.blogcdn.com/www.autoblog.com/media/2012/01/02-m-performance-diesels-628_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/01/02-m-performance-diesels-628.jpg <![CDATA[Followup: Infiniti M35h is world's "fastest" hybrid]]>http://www.autoblog.com/2012/01/24/followup-infiniti-m35h-is-worlds-fastest-hybrid/http://www.autoblog.com/2012/01/24/followup-infiniti-m35h-is-worlds-fastest-hybrid/http://www.autoblog.com/2012/01/24/followup-infiniti-m35h-is-worlds-fastest-hybrid/#commentsFiled under: , , , , , , ,

Infiniti M35h versus Porsche Panamera S Hybrid

We don't imagine that many new-car buyers are cross-shopping their local Infiniti and Porsche dealerships, but there's at least one segment of the automotive industry where the two automakers both play ball: high-performance hybrid luxury sedans, which may be the single most conflicted niche of the automotive sphere in the known universe.

In any case, here we are with the Infiniti M35h and Porsche Panamera S Hybrid. Each one is marketed as both a somewhat greener luxury vehicle and a performance sedan. We'd guess it's the performance side of the equation that would be most interesting to the majority of buyers, leaving fuel efficiency a welcome bonus.

So, which one is faster? That's an interesting question. Usually, we equate that term with top speed, as "fast" connotes velocity. When acceleration is being contested, we generally ask which machine is quickest. And, if it's quickness you're after, Infiniti wants you to know that its M35h will out-accelerate its competitor from Germany. How quick is it? According to Motor Trend, the hybrid M goes from 0-60 in 5.1 seconds, but that's not the stat Infiniti is claiming. According to the post-jump press release, the M35h is "faster" than the hybrid Panamera from 0-100 (11.54 seconds) and in the quarter mile (13.41 seconds).

As for the rest of the relevant statistics, the EPA estimates that the M35h will manage 27 miles per gallon in the city and 32 on the highway, for a combined rating of 29. The Porsche Panamera S Hybrid is rated at 22 city, 30 highway and 25 combined. Seems the M hybrid takes both the acceleration and economy awards. Check out a video released by Infiniti after the break, where you'll also find the press release, if you're into that kind of thing.

Continue reading Followup: Infiniti M35h is world's "fastest" hybrid

Followup: Infiniti M35h is world's "fastest" hybrid originally appeared on Autoblog on Tue, 24 Jan 2012 16:56:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>fastest hybridinfinitiinfiniti mmm hybridm35m35hpanamerapanamera s hybridporschequickest hybridvideoTue, 24 Jan 2012 16:56:00 EST http://www.autoblog.com/feed/20155579/article-comments.xml http://www.autoblog.com/feed/2012/01/24/followup-infiniti-m35h-is-worlds-fastest-hybrid/20155579/article-detail.xml 20155579 http://www.blogcdn.com/www.autoblog.com/media/2012/01/infiniti-m35h-porsche-panamera-hybrid_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/01/infiniti-m35h-porsche-panamera-hybrid.jpg <![CDATA[BMW M5 quicker than 1 M Coupe quicker than M3]]>http://www.autoblog.com/2011/12/29/bmw-m5-quicker-than-1-m-coupe-quicker-than-m3/http://www.autoblog.com/2011/12/29/bmw-m5-quicker-than-1-m-coupe-quicker-than-m3/http://www.autoblog.com/2011/12/29/bmw-m5-quicker-than-1-m-coupe-quicker-than-m3/#commentsFiled under: , , , , , ,

2012 BMW M5 front three-quarter

Autobild recently set out to settle the question of which M vehicle is the fastest in the BMW stable at the moment. Not surprisingly, the German enthusiast publication found the BMW M3 CRT to be the quickest around the Sachsenring, setting the magazine's fastest time around the track with a 1:38.37 minute lap time. That's impressive, but not nearly as astounding as the time drummed up by the new BMW M5. The portly sedan did the same deed in 1:38.90, or just three hundredths of a second slower than the special-edition M3.

And what of the sibling rivalry between the BMW 1 Series M Coupe and the standard M3? As it turns out, the magazine's shoes have given the nod to the smaller of the two coupes. The 1 Series M Coupe barely eked out a win over the M3, though the M3 Convertible took nearly two extra seconds to make it around the course than its hardtop twin.

BMW M5 quicker than 1 M Coupe quicker than M3 originally appeared on Autoblog on Thu, 29 Dec 2011 11:01:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>1 m coupe1 series1 series m1 series m coupe1m coupeautobildbmw 1 series m coupebmw mbmw m3bmw m5mm1m3m5Thu, 29 Dec 2011 11:01:00 EST http://www.autoblog.com/feed/20136715/article-comments.xml http://www.autoblog.com/feed/2011/12/29/bmw-m5-quicker-than-1-m-coupe-quicker-than-m3/20136715/article-detail.xml 20136715 http://www.blogcdn.com/www.autoblog.com/media/2011/09/2012-bmw-m5-fd_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/09/2012-bmw-m5-fd.jpg <![CDATA[Nissan initiates multi-vehicle recall over faulty bolts]]>http://www.autoblog.com/2011/12/24/nissan-initiates-multi-vehicle-recall-over-faulty-bolts/http://www.autoblog.com/2011/12/24/nissan-initiates-multi-vehicle-recall-over-faulty-bolts/http://www.autoblog.com/2011/12/24/nissan-initiates-multi-vehicle-recall-over-faulty-bolts/#commentsFiled under: , , , , , , , ,



Nissan is recalling just over 14,700 vehicles from the 2011 and 2012 model years over faulty bolts in the engine. According to the National Highway Traffic Safety Administration, "bolts that connect the engine oil cooler and the engine oil filter to the engine in these vehicles may have been manufactured to below specification strength."

Affected Nissan vehicles include the 2011-12 Pathfinder, 2011-12 Xterra, 2012 NV and 2012 Frontier. Additionally, the 2011 Infiniti FX and 2012 Infiniti M are being recalled for this issue.

The NHTSA report states that if there is an engine oil leak, pressure would drop and the engine could possibly seize. Bad news all around.

The recall is expected to kick off in mid-January, and Nissan dealers will replace the connector bolts free of charge. To read the full NHTSA report, follow the jump.

Continue reading Nissan initiates multi-vehicle recall over faulty bolts

Nissan initiates multi-vehicle recall over faulty bolts originally appeared on Autoblog on Sat, 24 Dec 2011 17:02:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>frontierfxinfinitimnissannvpathfinderrecallsafetyxterraSat, 24 Dec 2011 17:02:00 EST http://www.autoblog.com/feed/20134101/article-comments.xml http://www.autoblog.com/feed/2011/12/24/nissan-initiates-multi-vehicle-recall-over-faulty-bolts/20134101/article-detail.xml 20134101 http://www.blogcdn.com/www.autoblog.com/media/2011/12/01-nissan-infiniti-recall628_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/12/01-nissan-infiniti-recall628.jpg <![CDATA[Autoblog Podcast #260]]>http://www.autoblog.com/2011/12/13/autoblog-podcast-260-dodge-dart-scion-fr-s-bmw-ilx-6-series/http://www.autoblog.com/2011/12/13/autoblog-podcast-260-dodge-dart-scion-fr-s-bmw-ilx-6-series/http://www.autoblog.com/2011/12/13/autoblog-podcast-260-dodge-dart-scion-fr-s-bmw-ilx-6-series/#commentsFiled under: , , , , , , , , ,

Dodge Dart teased, Scion FR-S First Drive, Fiat 500 crash test, Acura NSX and ILX, BMW 6 Series Gran Coupe

autoblog podcast

Episode #260 of the Autoblog Podcast is here with Chris, Dan, Chris Paukert and Zach this week. Topics include the teaser images Chrysler has released of the 2012 Dodge Dart, our first drive of the Scion FR-S, the Fiat 500 crash test aftermath, A new Acura NSX and ILX, and the BMW 6 Series Gran Coupe. Your questions and comments power the end of the 'cast, and for those of you who hung with us live on our UStream channel, thanks for taking the time. We've embedded our Q&A module after the jump for you to scroll through and follow along, too. Thanks for listening!

Autoblog Podcast #260:
In the Autoblog Garage
2011 Chevrolet Silverado 1500 LTZ Crew Cab
2012 Land Rover Evoque
2012 Buick Regal eAssist
2012 Infiniti M37

Hosts: Dan Roth, Chris Shunk, Zach Bowman, Chris Paukert
Runtime: 01:27:53
Get the podcast
[UStream] Listen live on Mondays at 10PM Eastern at UStream
[iTunes] Subscribe to the Autoblog Podcast in iTunes
[RSS] Add the Autoblog Podcast feed to your RSS aggregator
[MP3] Download the MP3 directly

Feedback
Email: Podcast at Autoblog dot com
Voicemail: 734-288-8POD (734-288-8763)

Review the show in iTunes and take our survey

Continue reading Autoblog Podcast #260

Autoblog Podcast #260 originally appeared on Autoblog on Tue, 13 Dec 2011 14:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>5006 series6 series gran coupeacura ilxacura nsxautoblog podcastdartevoquefeaturedfr-silxmm37nsxregalscion fr-ssilveradoTue, 13 Dec 2011 14:15:00 ESTAutoblog Podcast #260Autoblog01:27:53 http://www.autoblog.com/feed/20127054/article-comments.xml http://www.autoblog.com/feed/2011/12/13/autoblog-podcast-260-dodge-dart-scion-fr-s-bmw-ilx-6-series/20127054/article-detail.xml 20127054 http://www.blogcdn.com/www.autoblog.com/media/2011/06/podcastlivev2stamp_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/06/podcastlivev2stamp.jpg <![CDATA[<i>Ward's</i> releases annual 10 Best Engines list]]>http://www.autoblog.com/2011/12/08/wards-releases-annual-10-best-engines-list/http://www.autoblog.com/2011/12/08/wards-releases-annual-10-best-engines-list/http://www.autoblog.com/2011/12/08/wards-releases-annual-10-best-engines-list/#commentsFiled under: , , , , , , , , , , , ,

2012 Ford Mustang Boss 302 engine

It's that time of year, folks. No, we're not referring to the oodles of time spent shopping for the holidays, we're talking about end-of-the-year lists. Kicking things off in the automotive spectrum is industry stalwart Ward's Auto, which has just released its annual 10 Best Engines list.

Without further ado, here are the award-winners for 2012:
It comes as little surprise that seven of the ten engines on the list feature the most recent advance in power and efficiency, namely direct injection, or that a full half of them are boosted with the addition of either a supercharger or a turbocharger. Perhaps more surprising is that there's only one hybrid powertrain on the list, and it's from Infiniti, not Toyota or Lexus.

In fact, there isn't a single engine from Honda or Toyota on 2011's edition of the 10 Best Engines, nor are the 1.4-liter/111kW electric motor package in the Chevrolet Volt or 80kW AC motor in the Nissan Leaf anywhere to be found - both of which were on the list in 2010. Also missing? A diesel... any diesel - and there certainly are a few options from the likes of Audi, BMW, Mercedes-Benz and Volkswagen from which to choose.

Though its neither direct-injected nor turbocharged, the Pentastar V6 from Chrysler is surely worthy of inclusion, if for no other reason than its single-handed ability to transform any vehicle it's in from an also-ran to a competitive proposition.

We'll also give a shout-out to Ford, which earned two spots on the list but could seemingly have garnered another for the excellent 3.5-liter EcoBoost engine in the F-150 pickup. Ward's has plenty of commentary on why each engine was chosen, and you can read all about it right here. But first, have a look at each powerplant in our high-res image gallery.

Ward's releases annual 10 Best Engines list originally appeared on Autoblog on Thu, 08 Dec 2011 13:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>10 best engines3 series3005 seriesa6accentdirect injectionecoboostedgeenginemm35hmazda3mustangmustang boss 302pentastarregalsoulwardswards 10 best engineswards autowranglerz4Thu, 08 Dec 2011 13:30:00 EST http://www.autoblog.com/feed/20123767/article-comments.xml http://www.autoblog.com/feed/2011/12/08/wards-releases-annual-10-best-engines-list/20123767/article-detail.xml 20123767 http://www.blogcdn.com/www.autoblog.com/media/2011/12/2012-ford-mustang-boss-302-engine_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/12/2012-ford-mustang-boss-302-engine.jpg <![CDATA[The BMW M table is too good for coffee]]>http://www.autoblog.com/2011/11/29/the-bmw-m-table-is-too-good-for-coffee/http://www.autoblog.com/2011/11/29/the-bmw-m-table-is-too-good-for-coffee/http://www.autoblog.com/2011/11/29/the-bmw-m-table-is-too-good-for-coffee/#commentsFiled under: ,



We aren't typically ones to geek out on furniture, but this warrants an exception to the rule. Phillips Collection has worked up a coffee table perfect for any BMW fan. From the side, the piece simply looks to be three tilted boxes, but view the table from above and it becomes clear that it's actually a physical manifestation of the BMW M logo. Made from cold-pressed steel and powder coated in the exact hues used by the BMW go-fast division, the table is sure to last for years and years. If you want one as badly as we do, you'll have to contact Phillips Collection for more information.

Designer Jason Phillips is based in Greensboro, North Carolina and has crafted a number of innovative tables and chairs. You can check out his full portfolio by heading over to his Behance page.

The BMW M table is too good for coffee originally appeared on Autoblog on Tue, 29 Nov 2011 15:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bmwbmw mbmw m tablebmw tablemm tablephillips collectionTue, 29 Nov 2011 15:30:00 EST http://www.autoblog.com/feed/20116482/article-comments.xml http://www.autoblog.com/feed/2011/11/29/the-bmw-m-table-is-too-good-for-coffee/20116482/article-detail.xml 20116482 http://www.blogcdn.com/www.autoblog.com/media/2011/11/m-table-opt_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/11/m-table-opt.jpg <![CDATA[Nissan, Mitsubishi confirm plans to share Fuga sedan]]>http://www.autoblog.com/2011/09/23/nissan-mitsubishi-confirm-plans-to-share-fuga-sedan/http://www.autoblog.com/2011/09/23/nissan-mitsubishi-confirm-plans-to-share-fuga-sedan/http://www.autoblog.com/2011/09/23/nissan-mitsubishi-confirm-plans-to-share-fuga-sedan/#commentsFiled under: , , , ,

Earlier this week, reports out of Japan stated that Nissan would be lending a version of its Fuga sedan to Mitsubishi. The Fuga, better known in the United States as the Infiniti M, would serve as Mitsubishi's new flagship sedan in the Japanese market. Now, the two automakers have released a statement confirming plans for Nissan to supply the Fuga to Mitsubishi, beginning in the summer of 2012. At this time, it is still unclear whether or not we'll see a Mitsubishi-baged Fuga here in the U.S. Hit the jump for the official release.

Continue reading Nissan, Mitsubishi confirm plans to share Fuga sedan

Nissan, Mitsubishi confirm plans to share Fuga sedan originally appeared on Autoblog on Fri, 23 Sep 2011 16:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>fugainfinitimmitsubishinissansedanFri, 23 Sep 2011 16:15:00 EST http://www.autoblog.com/feed/20051030/article-comments.xml http://www.autoblog.com/feed/2011/09/23/nissan-mitsubishi-confirm-plans-to-share-fuga-sedan/20051030/article-detail.xml 20051030 http://www.blogcdn.com/www.autoblog.com/media/2011/09/02-nissan-fuga-hybrid-press-1316806323_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/09/02-nissan-fuga-hybrid-press-1316806323.jpg <![CDATA[Mitsubishi to borrow Diamante successor from Nissan]]>http://www.autoblog.com/2011/09/22/mitsubishi-to-borrow-diamante-successor-from-nissan/http://www.autoblog.com/2011/09/22/mitsubishi-to-borrow-diamante-successor-from-nissan/http://www.autoblog.com/2011/09/22/mitsubishi-to-borrow-diamante-successor-from-nissan/#commentsFiled under: , , , ,

Nissan Fuga

Mitsubishi owners and car enthusiasts may recall a model called the Diamante. It was the Japanese automaker's flagship luxury sedan until it was discontinued in 2004. But now the time appears ripe to bring it back - in the Japanese domestic market, at least.

Rather than develop its own model, however, reports confirm earlier rumors indicating that Mitsubishi will rebadge a version of the Fuga produced by Nissan - a model better known to North American buyers as the Infiniti M. Nissan offers the Fuga/M with V6, V8, hybrid and diesel powertrains. It remains to be seen, however, which engines will find their way under the hood of the Mitsubishi version.

The arrangement is only the latest development in an ongoing partnership between Mitsubishi and Nissan that also includes a rebadged version of the Nissan NV200 Vanette, along with other models. However these exercises in badge engineering aren't expected, for the time being at least, to make it to the North American market.

Mitsubishi to borrow Diamante successor from Nissan originally appeared on Autoblog on Thu, 22 Sep 2011 13:02:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>diamantefugainfinitiinfiniti mjdmmmitsubishimitsubishi diamantenissannissan fugaThu, 22 Sep 2011 13:02:00 EST http://www.autoblog.com/feed/20049728/article-comments.xml http://www.autoblog.com/feed/2011/09/22/mitsubishi-to-borrow-diamante-successor-from-nissan/20049728/article-detail.xml 20049728 http://www.blogcdn.com/www.autoblog.com/media/2011/09/02-nissan-fuga-hybrid-press_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/09/02-nissan-fuga-hybrid-press.jpg <![CDATA[<i>Autocar</i> pits BMW 1 Series M Coupe against Porsche Cayman R]]>http://www.autoblog.com/2011/05/30/autocar-pits-bmw-1-series-m-coupe-against-porsche-cayman/http://www.autoblog.com/2011/05/30/autocar-pits-bmw-1-series-m-coupe-against-porsche-cayman/http://www.autoblog.com/2011/05/30/autocar-pits-bmw-1-series-m-coupe-against-porsche-cayman/#commentsFiled under: , , , , ,

2011 BMW 1M Coupe vs. 2011 Porsche Cayman R
2011 BMW 1 Series M Coupe vs. 2011 Porsche Cayman R - Click above to view video after the jump

The 2011 BMW 1 Series M Coupe has been setting hearts on fire across the automotive press since Munich started teasing the car a couple years ago. Now that it has finally arrived, Autocar decided to see if it lived up to its own hype when faced with the lithe 2011 Porsche Cayman R.

We'll save giving away the outcome of the comparison in the video, but suffice it to say the 1M Coupe satisfies expectations. It brings back the raw, visceral driving experience characteristic of the old M cars and is relatively affordable. All things we dig. With that knowledge safely in hand, click past the jump to see how the little M rocket stacks up to the competition.

Continue reading Autocar pits BMW 1 Series M Coupe against Porsche Cayman R

Autocar pits BMW 1 Series M Coupe against Porsche Cayman R originally appeared on Autoblog on Mon, 30 May 2011 20:02:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>1 series1 series m coupe2011 bmw 1 series m coupe2011 porsche cayman rbmwcayman rmporscheMon, 30 May 2011 20:02:00 EST http://www.autoblog.com/feed/19953546/article-comments.xml http://www.autoblog.com/feed/2011/05/30/autocar-pits-bmw-1-series-m-coupe-against-porsche-cayman/19953546/article-detail.xml 19953546 http://www.blogcdn.com/www.autoblog.com/media/2011/05/1m-vs-caymanr-lead_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/05/1m-vs-caymanr-lead.jpg <![CDATA[2012 Infiniti M35h]]>http://www.autoblog.com/2011/04/26/2012-infiniti-m35h-quick-spin-review-road-test/http://www.autoblog.com/2011/04/26/2012-infiniti-m35h-quick-spin-review-road-test/http://www.autoblog.com/2011/04/26/2012-infiniti-m35h-quick-spin-review-road-test/#commentsFiled under: , , , ,

Appealing To Both The Fast And Frugal

2012 Infiniti M35h
2012 Infiniti M35h - Click above for high-res image gallery

It is time for enthusiasts to embrace hybrid powertrain technology. A few short years ago, the mention of "hybrid power" conjured up images of low displacement engines, tiny electric boost motors and lethargic performance. Sure, the vehicles were environmentally-friendly (on a local level, at least) and they spanked their pure-combustion counterparts when it came to fueling stops, but they were also absolutely boring to drive. No, make that numbing.

Of course, there are always a few exceptions to the rule. Vehicles including the Lexus LS 600h L, Lexus GS 450h, BMW ActiveHybrid 750i and BMW ActiveHybrid X6 deliver spirited performance, but only mediocre improvements over their gas-only siblings when it comes to efficiency. And, we don't need to remind you that these vehicles are always very complex, excessively heavy and hardly inexpensive - there were simply few compelling reasons to put one in the garage.

Infiniti, a brand in itself almost embarrassing late to the hybrid game, seems to be in a position to change all that.

Continue reading Quick Spin: 2012 Infiniti M35h...


Gallery: 2012 Infiniti M35h: Quick Spin

2012 Infiniti M35h2012 Infiniti M35h2012 Infiniti M35h2012 Infiniti M35h2012 Infiniti M35h

Photos copyright (C)2011 Chris Shunk / AOL

Continue reading 2012 Infiniti M35h

2012 Infiniti M35h originally appeared on Autoblog on Tue, 26 Apr 2011 11:58:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2012 infiniti m35hfeaturedinfinitiinfiniti mmm35hquick spinquickspinTue, 26 Apr 2011 11:58:00 EST http://www.autoblog.com/feed/19885599/article-comments.xml http://www.autoblog.com/feed/2011/04/26/2012-infiniti-m35h-quick-spin-review-road-test/19885599/article-detail.xml 19885599 http://www.blogcdn.com/www.autoblog.com/media/2011/04/03-2012-infiniti-m35h-qs-opt_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/04/03-2012-infiniti-m35h-qs-opt.jpg <![CDATA[Leaked? 2012 BMW 6 Series M-Sport package rears its sporty head]]>http://www.autoblog.com/2011/04/21/leaked-2012-bmw-6-series-m-sport-package-rears-its-sporty-head/http://www.autoblog.com/2011/04/21/leaked-2012-bmw-6-series-m-sport-package-rears-its-sporty-head/http://www.autoblog.com/2011/04/21/leaked-2012-bmw-6-series-m-sport-package-rears-its-sporty-head/#commentsFiled under: , , , ,

BMW 6 Series M Sport Package leak

When BMW unveils a new sports coupe, it's an exciting development. If not in its own right, then because you know it's going to lead to a new M model. And so the new 6 Series will lead to a new M6, but not just yet.

That's where the M-Sport package comes in. Though the trim pack for the new 6 Series has yet to be released, this solitary (grainy) image has apparently leaked out via an ad in a Dutch newspaper.

As with other models, this new M-Sport pack serves a dual purpose. Ostensibly it gives buyers of the standard model a little extra in the cosmetic department for a sportier look. But it may also give us a little heads-up on how the full-on M6 will look whenever it's finally released. So take a good long look at the bigger wheels and the new front bumper with integrated LED running lights, and bide your time until the new M6 comes along.

[Source: 6post.com via TopSpeed]

Leaked? 2012 BMW 6 Series M-Sport package rears its sporty head originally appeared on Autoblog on Thu, 21 Apr 2011 09:20:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>2012 bmw 6 series2012 bmw 6 series coupe6 series6-seriesbmwbmw 6 seriesbmw 6 series coupebmw mmm-sportm-sport packagem6Thu, 21 Apr 2011 09:20:00 EST http://www.autoblog.com/feed/19918862/article-comments.xml http://www.autoblog.com/feed/2011/04/21/leaked-2012-bmw-6-series-m-sport-package-rears-its-sporty-head/19918862/article-detail.xml 19918862 http://www.blogcdn.com/www.autoblog.com/media/2011/04/bmw-6-series-m-sport_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/04/bmw-6-series-m-sport.jpg <![CDATA[Rumormill: Light BMW M Concept coming to Tokyo Motor Show]]>http://www.autoblog.com/2011/03/24/rumormill-light-bmw-m-concept-coming-to-tokyo-motor-show/http://www.autoblog.com/2011/03/24/rumormill-light-bmw-m-concept-coming-to-tokyo-motor-show/http://www.autoblog.com/2011/03/24/rumormill-light-bmw-m-concept-coming-to-tokyo-motor-show/#commentsFiled under: , , , , , ,

BMW M Concept Sketch

The forums are alight with word that BMW will be bringing something unique to this year's Tokyo Motor Show. According to the BMW-obsessed crowd over at M3Post.com, the Roundel is looking to flex its muscles when it comes to lightweight engineering with an M concept that boasts the best the company has to offer. Supposedly, the chassis will use a plethora of exotic materials to shave off every last pound, including magnesium, titanium, thermoplastic and carbon fiber. Unfortunately, it sounds like the concept will be a one-off piece and not something that's destined for production. A real shame since we could really go for a 1 Series CSL.

That doesn't mean BMW won't use the technology in the concept in its production vehicles, though. The German manufacturer has made it clear that carbon-fiber reinforced plastic is going to be a big part of its vehicles moving forward, and we wouldn't be surprised to see the material joined by other lightweight components as shedding pounds becomes increasingly important to meeting fuel economy and performance goals.

[Source: M3 Post]

Rumormill: Light BMW M Concept coming to Tokyo Motor Show originally appeared on Autoblog on Thu, 24 Mar 2011 20:24:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>bmwbmw mcarbon fiberconceptcsllightweight conceptmm concepttokyo motor showThu, 24 Mar 2011 20:24:00 EST http://www.autoblog.com/feed/19891052/article-comments.xml http://www.autoblog.com/feed/2011/03/24/rumormill-light-bmw-m-concept-coming-to-tokyo-motor-show/19891052/article-detail.xml 19891052 http://www.blogcdn.com/www.autoblog.com/media/2011/03/17-bmw-vision-connecteddrive-630op_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/03/17-bmw-vision-connecteddrive-630op.jpg <![CDATA[2012 Infiniti M Hybrid priced from $53,700]]>http://www.autoblog.com/2011/02/23/2012-infiniti-m-hybrid-priced-from-53-700/http://www.autoblog.com/2011/02/23/2012-infiniti-m-hybrid-priced-from-53-700/http://www.autoblog.com/2011/02/23/2012-infiniti-m-hybrid-priced-from-53-700/#commentsFiled under: , , , ,

2012 Infiniti M Hybrid
2012 Infiniti M Hybrid - Click above for high-res image gallery

Infiniti is touting its 2012 M Hybrid as the "only vehicle in America to offer more than 350 horsepower and 30-plus miles per gallon." If that sounds like an excellent combination, the Japanese automaker has just announced that the cost of entry is $53,700.

The 30-plus mpg figure is, of course, on the highway, with an EPA estimated fuel economy rating of 32 mpg. The M Hybrid is rated at 27 mpg in the city and has a combined rating of 29 - not too shabby for a car with 360-horsepower on tap, courtesy of the 3.5-liter V6 mounted under the hood. $53,700 is a lot of scratch, but there's not a lot of luxury sedans on the market that offer that much power while retuning that type of fuel economy. Hit the jump for the official press release.


Gallery: LA 2010: Infiniti M Hybrid

2012 Infiniti M Hybrid2012 Infiniti M Hybrid2012 Infiniti M Hybrid2012 Infiniti M Hybrid2012 Infiniti M Hybrid

Photos copyright (C)2011 Drew Phillips / AOL

[Source: Infiniti]

Continue reading 2012 Infiniti M Hybrid priced from $53,700

2012 Infiniti M Hybrid priced from $53,700 originally appeared on Autoblog on Wed, 23 Feb 2011 16:31:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2012 infiniti m hybridinfinitimm hybridWed, 23 Feb 2011 16:31:00 EST http://www.autoblog.com/feed/19856038/article-comments.xml http://www.autoblog.com/feed/2011/02/23/2012-infiniti-m-hybrid-priced-from-53-700/19856038/article-detail.xml 19856038 http://www.blogcdn.com/www.autoblog.com/media/2010/11/lead-infiniti-m35-hybrid-la-2010_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2010/11/lead-infiniti-m35-hybrid-la-2010.jpg <![CDATA[Rumormill: Mitsubishi to sell rebadged Infiniti M... new Diamante in the cards?]]>http://www.autoblog.com/2011/02/04/rumormill-mitsubishi-to-sell-rebadged-infiniti-m-new-diamant/http://www.autoblog.com/2011/02/04/rumormill-mitsubishi-to-sell-rebadged-infiniti-m-new-diamant/http://www.autoblog.com/2011/02/04/rumormill-mitsubishi-to-sell-rebadged-infiniti-m-new-diamant/#commentsFiled under: , , , ,

2011 Infiniti M37
2011 Infiniti M37 - Click above for high-res image gallery

Mitsubishi is reportedly considering selling a rebadged version of the Infiniti M sedan in order to fill its void of premium offerings in its home market of Japan. However, Automotive News notes that Mitsubishi's President, Osamu Masuko, has stated that the automaker will not leverage manufacturing deals with other companies in order to expand its lineup here in the United States, so don't expect to see a Mitsu-branded Infiniti on our shores anytime soon.

Mitsubishi's last endeavor into the luxury sedan market was with the Diamante - a car that suffered from lackluster sales numbers during its run throughout the 1990s and early 2000s. Due to Mitsubishi's financial woes during the mid-2000s, luxury car development was put on hold. Now, though, selling a rebadged version of the Infiniti M (or Nissan Fuga, as it's known in Japan) would insulate Mitsubishi from research and development costs, making it easier for the automaker to launch back into the luxury segment.

Automotive News reports that the Mitsubishi-badged Infiniti could go on sale in Japan as early as this year. Expect the standard gas version to be the first to wear a triple-diamond badge, though Mitsubishi may sell a version of the M Hybrid, as well. Top tip, Randy!


Gallery: 2011 Infiniti M37: Review


Photos copyright (C)2011 Michael Harley / AOL

[Source: Automotive News - sub. req.]

Rumormill: Mitsubishi to sell rebadged Infiniti M... new Diamante in the cards? originally appeared on Autoblog on Fri, 04 Feb 2011 11:00:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>diamantefugainfinitiinfiniti m37infiniti m56mmitsubishinissan fugaosamu masukoFri, 04 Feb 2011 11:00:00 EST http://www.autoblog.com/feed/19828837/article-comments.xml http://www.autoblog.com/feed/2011/02/04/rumormill-mitsubishi-to-sell-rebadged-infiniti-m-new-diamant/19828837/article-detail.xml 19828837 http://www.blogcdn.com/www.autoblog.com/media/2011/02/2011infinitim3701front34_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/02/2011infinitim3701front34.jpg <![CDATA[Review: 2011 Infiniti M37]]>http://www.autoblog.com/2010/10/12/2011-infiniti-m37-review-road-test/http://www.autoblog.com/2010/10/12/2011-infiniti-m37-review-road-test/http://www.autoblog.com/2010/10/12/2011-infiniti-m37-review-road-test/#commentsFiled under: , , ,

Can Luxury, Technology and Style Win Your Soul?

2011 Infiniti M37
2011 Infiniti M37 - Click above for high-res image gallery

Not too long ago, the Infiniti M was the lesser sibling to the flagship Q. It was the middle child. During the 2006 model year, when the Q was less than a year from being dropped from the lineup, Infiniti gave the M a strong shove in the back in the form of a 4.5-liter V8 and quietly told it to climb up on the soon-to-be-vacant throne. With the Q gone and unlikely to return anytime soon, the Infiniti M is now tasked with being the automaker's flagship sedan.

Completely redesigned for the 2011 model year, the Infiniti M is bigger and better than its predecessors ever were, but it still can't fill the Q's empty shoes. Shorted the substance and stature to battle the Lexus LS, the newest Japanese luxury sedan is relegated to fighting wars with the aged Lexus GS and Acura RL. But those two are the easy enemies. BMW, Audi, Mercedes-Benz and Cadillac are the ones fielding today's worthy adversaries.

We spent a week with the "entry level" Infiniti M37. While it isn't the range-topping M56, it does boast a proven 330-horsepower V6 and a luxuriously appointed cabin. Did we miss the eight-cylinder power? Should the Sports Package be a required purchase? What unique features does the gizmo-laden four-door offer? Most importantly, how well will it fare in this lion's den of a segment? Hit the jump to find out.


Gallery: 2011 Infiniti M37: Review


Photos copyright (C)2010 Michael Harley / AOL

Continue reading Review: 2011 Infiniti M37

Review: 2011 Infiniti M37 originally appeared on Autoblog on Tue, 12 Oct 2010 11:57:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2011 infiniti m372011 m37featuredinfinitiinfiniti m37mm37reviewreviewsTue, 12 Oct 2010 11:57:00 EST http://www.autoblog.com/feed/19669818/article-comments.xml http://www.autoblog.com/feed/2010/10/12/2011-infiniti-m37-review-road-test/19669818/article-detail.xml 19669818 http://www.blogcdn.com/www.autoblog.com/media/2010/10/2011infinitim3701front34opt_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2010/10/2011infinitim3701front34opt.jpg <![CDATA[BMW 1M Coupe stops by Paris, doesn't even stay for the show]]>http://www.autoblog.com/2010/10/06/bmw-1m-coupe-stops-by-paris-doesnt-even-stay-for-the-show/http://www.autoblog.com/2010/10/06/bmw-1m-coupe-stops-by-paris-doesnt-even-stay-for-the-show/http://www.autoblog.com/2010/10/06/bmw-1m-coupe-stops-by-paris-doesnt-even-stay-for-the-show/#commentsFiled under: , , ,

BMW 1M coupe striptease in Paris
BMW 1M Coupe teasers - Click above for image gallery

Between the 6 Series Coupe concept, the 5 Series Touring wagon and the new X3 crossover, BMW had plenty to show us this year at the Paris Motor Show. But the real surprise, as it turns out, may have been in the French capital during the show, it wasn't even put on display. Instead, the Bavarian automaker took its currently-in-progress 1M Coupe out onto the city's famous tree-lined boulevards, covered up and disguised, but did a suitably Parisian burlesque striptease to give us a glimpse at what to expect.

Aside from the silhouette, all we can see are the front fender, headlamp (which is now taped-up in Zorro-esque fashion for some reason) and part of the air dam - all of which we saw before in the last teaser video - along with a newly-revealed section of the rear bumper and quad-pipe exhaust, plus the wheels protruding from the flared arches. If previous reports prove accurate, there will only be 2,700 examples on offer, so this may be the best look we'll get for some time... better check it out in the gallery below. Thanks for the tip, Jason!


Gallery: BMW 1M Coupe teasers


[Source: BMW M-Power via 1Addicts]

BMW 1M Coupe stops by Paris, doesn't even stay for the show originally appeared on Autoblog on Wed, 06 Oct 2010 11:28:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>1 m1 m coupe1 series1 series m1 series m coupe1M1Series2010 paris2010 paris motor show2010Paris2010ParisMotorShowbmwbmw 1 seriesbmw 1 series mbmw 1 series m coupebmw 1m coupeBmw1SeriesMMparisparis 2010paris motor show 2010Paris2010ParisMotorShow2010teaserWed, 06 Oct 2010 11:28:00 EST http://www.autoblog.com/feed/19663168/article-comments.xml http://www.autoblog.com/feed/2010/10/06/bmw-1m-coupe-stops-by-paris-doesnt-even-stay-for-the-show/19663168/article-detail.xml 19663168 http://www.blogcdn.com/www.autoblog.com/media/2010/10/web630-1m-tease4_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2010/10/web630-1m-tease4.jpg <![CDATA[Report: Infiniti mulling more rear-wheel-drive hybrids]]>http://www.autoblog.com/2010/08/23/report-infiniti-mulling-more-rear-wheel-drive-hybrids/http://www.autoblog.com/2010/08/23/report-infiniti-mulling-more-rear-wheel-drive-hybrids/http://www.autoblog.com/2010/08/23/report-infiniti-mulling-more-rear-wheel-drive-hybrids/#commentsFiled under: , ,

Infiniti M35 Hybrid
Infiniti M35 Hybrid - Click above for high-res image gallery

The Infiniti M35 Hybrid won't be hitting showrooms until Spring 2011, but that doesn't mean future applications of the hybrid powertrain aren't already in the works. Speaking with Automotive News, Nissan North America's vice president of product planning, Larry Dominique, says that the M35's hybrid drivetrain was designed to fit all of Infiniti's rear-wheel drive models, not just the flagship M.

Infiniti's new hybrid system is the first gasoline-electric powerplant solely designed by Nissan (the Altima Hybrid uses a Toyota-sourced unit). Once the M35 launches, we could see new hybrid versions of the G, EX and FX models, though we'd expect those to come long after the initial launch of the M35.

Currently, the market for rear-wheel-drive hybrid sedans is very small, with the Lexus GS 450h and LS 600h, Mercedes-Benz S400 and BMW 7 Series ActiveHybrid making up the entire segment. More entries are expected to arrive over the next few years, and Infiniti will surely test the waters with the M35 before electrifying any more models within its lineup.


Gallery: Infiniti M35 Hybrid


[Source: Automotive News - sub. req.]

Report: Infiniti mulling more rear-wheel-drive hybrids originally appeared on Autoblog on Mon, 23 Aug 2010 15:32:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>2012 infiniti m hybridinfinitiinfiniti hybridInfinitiHybridmm35Mon, 23 Aug 2010 15:32:00 EST http://www.autoblog.com/feed/19604528/article-comments.xml http://www.autoblog.com/feed/2010/08/23/report-infiniti-mulling-more-rear-wheel-drive-hybrids/19604528/article-detail.xml 19604528 http://www.blogcdn.com/www.autoblog.com/media/2010/08/m35hybridopt_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2010/08/m35hybridopt.jpg <![CDATA[Cadillac CTS, Infiniti M models earn Top Safety Pick status from IIHS]]>http://www.autoblog.com/2010/08/16/cadillac-cts-infiniti-m-models-earn-top-safety-pick-status-from/http://www.autoblog.com/2010/08/16/cadillac-cts-infiniti-m-models-earn-top-safety-pick-status-from/http://www.autoblog.com/2010/08/16/cadillac-cts-infiniti-m-models-earn-top-safety-pick-status-from/#commentsFiled under: , , , , , , , ,



The Insurance Institute for Highway Safety has put a new crop of large luxury vehicles through its crash test gauntlet, and the Cadillac CTS and Infiniti M joined some impressive company in scoring a Top Safety Pick designation. The CTS and M clinched the highly regarded award by receiving the top score of "Good" in roof strength testing. To achieve the top score in rollover safety, a vehicle's roof has to be able to support four times the weight of the entire vehicle.

The Top Safety Pick designation is handed out only to vehicles that received a "Good" score for all four IIHS crash tests while also featuring standard stability control to help avoid accidents altogether. The Cadillac and Infiniti join the BMW 5 Series, Lincoln MKS, Volvo S80, Hyundai Genesis and the Mercedes-Benz E-Class as Top Safety Pick winners.

Since large luxury vehicles cost so much and contain so many safety features, it's not all that surprising that so many models aced IIHS testing. But not all vehicles passed the test with flying colors. The Lexus GS and Audi A6 managed only an "Acceptable" score in roof testing, while the aging Acura RL lagged behind the competition with a "Marginal" rating. Hit the jump to read over the IIHS presser.


Gallery: 2011 Cadillac CTS sedan


Gallery: 2011 Infiniti M


[Source: Insurance Institute for Highway Safety]

Continue reading Cadillac CTS, Infiniti M models earn Top Safety Pick status from IIHS

Cadillac CTS, Infiniti M models earn Top Safety Pick status from IIHS originally appeared on Autoblog on Mon, 16 Aug 2010 16:01:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2010 top safety picks iihs2010TopSafetyPicksIihsA6Acura RLAcuraRlcadillac cts top safety pickCadillacCtsTopSafetyPickCTSGSIIHSiihs roof testsIIHS top safety pickIihsRoofTestsIihsTopSafetyPickInfiniti Minfiniti m top safety pickInfinitiMInfinitiMTopSafetyPickInsurance Institute for Highway SafetyInsuranceInstituteForHighwaySafetylarge luxury IIHS roof testingLargeLuxuryIihsRoofTestingLexus GSLexusGsMM 56M35M56RLMon, 16 Aug 2010 16:01:00 EST http://www.autoblog.com/feed/19594279/article-comments.xml http://www.autoblog.com/feed/2010/08/16/cadillac-cts-infiniti-m-models-earn-top-safety-pick-status-from/19594279/article-detail.xml 19594279 http://www.blogcdn.com/www.autoblog.com/media/2010/08/iihs-safety-roof_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2010/08/iihs-safety-roof.jpg -1 2