Autoblog http://www.autoblog.com Autoblog http://www.blogsmithmedia.com/www.autoblog.com/media/feedlogo.gif Autoblog http://www.autoblog.com en-us Copyright 2013 Weblogs, Inc. The contents of this feed are available for non-commercial use only. Blogsmith http://www.blogsmith.com/<![CDATA[2013 Nissan Frontier gets substantial price drop, better fuel economy]]>http://www.autoblog.com/2013/03/04/nissan-frontier-gets-substantial-price-drop-for-2013-better-fue/http://www.autoblog.com/2013/03/04/nissan-frontier-gets-substantial-price-drop-for-2013-better-fue/http://www.autoblog.com/2013/03/04/nissan-frontier-gets-substantial-price-drop-for-2013-better-fue/#commentsFiled under: ,



With the competition dwindling (or dying) among compact trucks, Nissan is looking to make some minor changes to the 2013 Frontier to snag a few extra sales for its aging pickup. Pricing and fuel economy are probably two of the most important vehicle stats among new-car buyers, and the 2013 Nissan Frontier has made vast improvements in both areas over the 2012 model.

First things first: The MSRP of both the King Cab and Crew Cab models have dropped by $1,270 with new starting prices of $17,990 and $22,030 (*not including the $845 destination charge), respectively. The biggest price drop is seen on the SV Crew Cab 4x2, which dropped $1,450 to its new price of $23,990. The important thing here is that the 2013 Frontier King Cab is now priced just a few hundred dollars more than a regular cab version of the Toyota Tacoma. Nissan is also offering a new SV Value Truck Package that includes all the equipment of the previous SV Premium Utility Package (spray-on bedliner, Utili-Track in-bed cargo system with four adjustable cleats and Bluetooth) and adds in a rearview monitor and dual-zone air conditioning.

Another key change made for 2013 was to the Frontier's fuel economy. Except for the base-model truck (King Cab, inline-four, manual transmission, two-wheel drive), all other configurations have seen increases in city and/or highway fuel economy to the tune of one or two miles per gallon; the biggest improvement was to the V6 models with the automatic transmission, which saw an improvement of one mpg city and two mpg highway. Nissan accomplished this with better aerodynamics and updated internal engine components to reduce friction. Aero changes include a seal between the cab and bed, a tailgate spoiler and a new front chin spoiler. For more details on the 2013 Frontier - including a full pricing breakdown - scroll down for the official press release.

Continue reading 2013 Nissan Frontier gets substantial price drop, better fuel economy

2013 Nissan Frontier gets substantial price drop, better fuel economy originally appeared on Autoblog on Mon, 04 Mar 2013 18:15:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2013 nissan frontier2013 nissan frontier fuel economy2013 nissan frontier msrpfrontiernissanpickup truckMon, 04 Mar 2013 18:15:00 EST http://www.autoblog.com/feed/20486894/article-comments.xml http://www.autoblog.com/feed/2013/03/04/nissan-frontier-gets-substantial-price-drop-for-2013-better-fue/20486894/article-detail.xml 20486894 http://www.blogcdn.com/www.autoblog.com/media/2013/03/2013-nissan-frontier-628_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2013/03/2013-nissan-frontier-628.jpg <![CDATA[2012 Nissan Frontier Crew Cab 4x4]]>http://www.autoblog.com/2012/12/27/2012-nissan-frontier-crew-cab-4x4-review/http://www.autoblog.com/2012/12/27/2012-nissan-frontier-crew-cab-4x4-review/http://www.autoblog.com/2012/12/27/2012-nissan-frontier-crew-cab-4x4-review/#commentsFiled under: , ,

The Right-Sized Truck Shows Its Age

2012 Nissan Frontier Crew Cab 4x4

Sometime during the mid '90s, the Big Three stepped up the fullsize truck arms race in a serious way. While Chrysler, Ford and General Motors had always fought tooth and nail for every last possible customer, suddenly trucks began evolving into more than just utilitarian work horses. While the old payload and towing one-upmanship continued in earnest, pickup design began swelling with broad grilles, massive wheels and flanks to match. Option sheets suddenly glittered with choices previously confined to luxury vehicles, and MSRPs began covering wide territory as base models got cheaper and upper trims explored new fiscal heights.

With all of Detroit's resources going to the fullsize game, domestic midsize entries like the Ford Ranger, Dodge Dakota, GMC Canyon and Chevrolet Colorado were left to rot on the vine. After all, why would buyers want to pony up equivalent cash for a less capable truck? Because, as the 2012 Nissan Frontier quietly reminds us, getting a job done is never about having the biggest tool. It's about having the one that's right for the task at hand.

Continue reading 2012 Nissan Frontier Crew Cab 4x4

2012 Nissan Frontier Crew Cab 4x4 originally appeared on Autoblog on Thu, 27 Dec 2012 11:59:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2012 nissan frontierfeaturedfrontiernissanreviewreviewsThu, 27 Dec 2012 11:59:00 EST http://www.autoblog.com/feed/20411572/article-comments.xml http://www.autoblog.com/feed/2012/12/27/2012-nissan-frontier-crew-cab-4x4-review/20411572/article-detail.xml 20411572 http://www.blogcdn.com/www.autoblog.com/media/2012/12/2012-nissan-frontier-review_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/12/2012-nissan-frontier-review.jpg <![CDATA[<i>Four Wheeler</i> crowns Ultimate Factory 4x4... who wins?]]>http://www.autoblog.com/2012/11/15/four-wheeler-crowns-ultimate-factory-4x4-who-wins/http://www.autoblog.com/2012/11/15/four-wheeler-crowns-ultimate-factory-4x4-who-wins/http://www.autoblog.com/2012/11/15/four-wheeler-crowns-ultimate-factory-4x4-who-wins/#commentsFiled under: , , , , , , ,

Ultimate Factory 4x4

Nearly every automaker doing business in the SUV or pickup truck segments offers a package designed to improve the off-road capabilities of its wares. But, of course, not all such factory kits are created equal. How, then, to separate the wheat from the chaff? Gather each of them up and put them through their paces, naturally.

The folks from Four Wheeler and PickupTrucks.com joined forces to run just such a comparison test, with the winner named the Ultimate Factory 4x4. A total of seven vehicles showed up to the fight: the 2012 Ford F-150 SVT Raptor, 2013 Jeep Wrangler Rubicon, 2012 Nissan Frontier PRO-4X and Xterra PRO-4X, 2012 Ram Power Wagon, and 2012 Toyota 4Runner Trail and Tacoma TRD T|X Baja Series.

With the contestants in place, the whole crew put each vehicle through a battery of tests that included skidpad and acceleration measurements, a hillclimb, a rocky stairstep course and a rock garden. Considering the nature of the beasts, on-road ride and comfort were not part of the routine.

So, which four-wheeler ended up on top? Click here to read the results, and don't act like you're surprised by the victor.

Four Wheeler crowns Ultimate Factory 4x4... who wins? originally appeared on Autoblog on Thu, 15 Nov 2012 11:31:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>4runnerF-150 SVT Raptorfactory off-roadfordfour wheelerfrontierjeepnissanoff roadpower wagonramtacomatoyotaultimate factory 4x4wranglerxterraThu, 15 Nov 2012 11:31:00 EST http://www.autoblog.com/feed/20380104/article-comments.xml http://www.autoblog.com/feed/2012/11/15/four-wheeler-crowns-ultimate-factory-4x4-who-wins/20380104/article-detail.xml 20380104 http://www.blogcdn.com/www.autoblog.com/media/2012/11/ultimate-factory-4x4_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/11/ultimate-factory-4x4.jpg <![CDATA[Autoblog Podcast #307]]>http://www.autoblog.com/2012/11/06/autoblog-podcast-307/http://www.autoblog.com/2012/11/06/autoblog-podcast-307/http://www.autoblog.com/2012/11/06/autoblog-podcast-307/#commentsFiled under: , , , , , , ,

Suzuki bankruptcy, Hyundai/Kia mileage, Scion FR-S supercharger, Tesla Model S awards, Consumer Reports top 10 most reliable American cars

autoblog podcast logo

Episode #307 of the Autoblog Podcast is here, and this week, Dan Roth, Zach Bowman and Jeff Ross talk about Suzuki departing the US market, the debacle surrounding Hyundai and Kia fuel economy numbers, rumors of a Scion FR-S supercharger kit, the Tesla Model S being named one of the best inventions of 2012 by Time magazine and Consumer Reports ranking its top 10 most reliable American cars. For those of you who hung with us live on our UStream channel, thanks for taking the time. Keep reading for our Q&A module for you to scroll through and follow along, too. Thanks for listening!

Autoblog Podcast #307:



Topics:

In the Autoblog Garage:
2012 Scion iQ
2012 Nissan Frontier
2013 Mazda MX-5 Miata

Hosts: Dan Roth, Zach Bowman, Jeff Ross
Runtime: 01:17:49

Get the podcast
[UStream] Listen live on Mondays at 10PM Eastern at UStream
[iTunes] Subscribe to the Autoblog Podcast in iTunes
[RSS] Add the Autoblog Podcast feed to your RSS aggregator
[MP3] Download the MP3 directly

Feedback
Email: Podcast at Autoblog dot com

Review the show in iTunes

Continue reading Autoblog Podcast #307

Autoblog Podcast #307 originally appeared on Autoblog on Tue, 06 Nov 2012 16:45:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>autoblog podcastconsumer reportsfeaturedfr-sfrontierhyundaihyundai fuel economyiqkiakia fuel economymiatamodel smx-5 miatateslaTue, 06 Nov 2012 16:45:00 ESTAutoblog Podcast #307Autoblog01:17:49 http://www.autoblog.com/feed/20372396/article-comments.xml http://www.autoblog.com/feed/2012/11/06/autoblog-podcast-307/20372396/article-detail.xml 20372396 http://www.blogcdn.com/www.autoblog.com/media/2011/06/podcastlivev2stamp_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/06/podcastlivev2stamp.jpg <![CDATA[Nissan recalling select 2012 Frontier, Pathfinder and Xterra models over wheel hub fractures]]>http://www.autoblog.com/2012/10/03/nissan-recalling-select-2012-frontier-pathfinder-and-xterra-mod/http://www.autoblog.com/2012/10/03/nissan-recalling-select-2012-frontier-pathfinder-and-xterra-mod/http://www.autoblog.com/2012/10/03/nissan-recalling-select-2012-frontier-pathfinder-and-xterra-mod/#commentsFiled under: , , , , ,



The Nissan Frontier, Xterra and Pathfinder might all be rugged trucks and SUVs, but two-wheel-drive versions of these vehicles are being recalled due to front suspension components that could possibly fail. According to the National Highway Traffic Safety Administration, Nissan is recalling about 2,400 of these models due to defective front wheel hubs that were installed on 2012 model-year vehicles built from June 19 through July 12.

Wheel hubs that are faulty could crack and possibly break, which could cause the vehicle to be disabled or get into an accident. NTHSA did not specify if any accidents were reported as a result of this concern, but it appears Nissan caught the problem early enough to limit any large-scale problems. To resolve this recall, Nissan is replacing both front wheel hubs on all affected two-wheel-drive Frontiers, Xterras and Pathfinders.

Nissan will start notifying affected customers on October 8, but check out NHTSA's press release below for more information.

Continue reading Nissan recalling select 2012 Frontier, Pathfinder and Xterra models over wheel hub fractures

Nissan recalling select 2012 Frontier, Pathfinder and Xterra models over wheel hub fractures originally appeared on Autoblog on Wed, 03 Oct 2012 08:46:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2012 nissan frontier recall2012 nissan pathfinder recall2012 nissan xterra recallfrontiernissannissan recallpathfinderrecallxterraWed, 03 Oct 2012 08:46:00 EST http://www.autoblog.com/feed/20339814/article-comments.xml http://www.autoblog.com/feed/2012/10/03/nissan-recalling-select-2012-frontier-pathfinder-and-xterra-mod/20339814/article-detail.xml 20339814 http://www.blogcdn.com/www.autoblog.com/media/2012/10/2012-nissan-frontier_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/10/2012-nissan-frontier.jpg <![CDATA[PickupTrucks.com holds Ultimate 4x4 Challenge]]>http://www.autoblog.com/2012/09/18/pickuptrucks-com-holds-ultimate-4x4-challenge/http://www.autoblog.com/2012/09/18/pickuptrucks-com-holds-ultimate-4x4-challenge/http://www.autoblog.com/2012/09/18/pickuptrucks-com-holds-ultimate-4x4-challenge/#commentsFiled under: , , , , , ,

Mark Williams of PickupTrucks.com with 2012 Ultimate 4x4 Challenge competitors

The crew at PickupTrucks.com has been busy lately. In addition to wrapping up its global pickup shootout in Australia, the site also took the time to pit four factory off-road kings against each other. After extending invitations to every manufacturer to send out their most capable pickup, the Nissan Frontier PRO-4X, Toyota Tacoma Baja, Ram Power Wagon and Ford F-150 SVT Raptor all showed up to play. General Motors, meanwhile, declined to join the party.

Each of the participants threw down in a total of 10 events with separate scoring, including old standbys like 0-60, 60-0, payload capacity and fuel economy. But Pickuptrucks.com also partnered up with 4Wheeler Magazine to put the bruisers through some legitimate off-road tests. Each pickup took on a tough sand hill climb as well as a stair climb and a rock scramble.

While we weren't surprised to see the Ford F-150 SVT Raptor take top honors, we were shocked to see where the Power Wagon wound up on the list. How'd the big Mopar place? You'll have to scroll down to watch the video wrap-up. After that, head on over to PickupTrucks.com to read the full comparison.

Continue reading PickupTrucks.com holds Ultimate 4x4 Challenge

PickupTrucks.com holds Ultimate 4x4 Challenge originally appeared on Autoblog on Tue, 18 Sep 2012 19:59:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>15002013 ford f-150 svt raptor2013 nissan frontier pro-4x2013 ram power wagon2013 toyota tacoma baja4wheeler magazinef-150frontiernissanpower wagonsvt raptortacomatoyotaultimate 4x4 shootoutvideoTue, 18 Sep 2012 19:59:00 EST http://www.autoblog.com/feed/20326724/article-comments.xml http://www.autoblog.com/feed/2012/09/18/pickuptrucks-com-holds-ultimate-4x4-challenge/20326724/article-detail.xml 20326724 http://www.blogcdn.com/www.autoblog.com/media/2012/09/mark-williams-of-pickuptrucks.com-with-4x4s_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/09/mark-williams-of-pickuptrucks.com-with-4x4s.jpg <![CDATA[Why has Nissan started to advertise the Frontier again? Ford killing the Ranger [w/video]]]>http://www.autoblog.com/2012/01/11/why-has-nissan-started-to-advertise-the-frontier-again-ford-kil/http://www.autoblog.com/2012/01/11/why-has-nissan-started-to-advertise-the-frontier-again-ford-kil/http://www.autoblog.com/2012/01/11/why-has-nissan-started-to-advertise-the-frontier-again-ford-kil/#commentsFiled under: , , , ,

Nissan Frontier barrel roll commercial screencap

The Ford Ranger has finally been shown the door, and Nissan apparently wants to seize the opportunity to make its Frontier the the standout in what remains of the compact pickup truck segment. Though the sun has been setting on the Ranger for some time, it's still outselling the Frontier - even after Nissan kicked up its marketing efforts as a way to grab the real estate Ford is cedeing by creating the first advertising campaign for the Frontier in four years.

That's not to say the Frontier is doing poorly; Nissan moved more than 50,000 out the door in 2011. That's 20,000 fewer than the Ranger's 70,000 unit performance, and well behind the 500,000-plus F-Series pickup models Ford shifts, but the aging Frontier is the popular sister in the Nissan truck family. Just 22,000 Nissan Titan full-size pickups found a home last year, though the latter is another product that's been languishing on the market with little marketing effort behind it. The Frontier might do better without the Ranger around regardless, but a commercial about a snowboarding truck couldn't hurt. Check it out after the jump.

Continue reading Why has Nissan started to advertise the Frontier again? Ford killing the Ranger [w/video]

Why has Nissan started to advertise the Frontier again? Ford killing the Ranger [w/video] originally appeared on Autoblog on Wed, 11 Jan 2012 14:01:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2012 nissan frontierfrontiernissannissan frontiernissan frontier commercialnissan videovideoWed, 11 Jan 2012 14:01:00 EST http://www.autoblog.com/feed/20143428/article-comments.xml http://www.autoblog.com/feed/2012/01/11/why-has-nissan-started-to-advertise-the-frontier-again-ford-kil/20143428/article-detail.xml 20143428 http://www.blogcdn.com/www.autoblog.com/media/2012/01/frontierspot_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2012/01/frontierspot.jpg <![CDATA[Nissan initiates multi-vehicle recall over faulty bolts]]>http://www.autoblog.com/2011/12/24/nissan-initiates-multi-vehicle-recall-over-faulty-bolts/http://www.autoblog.com/2011/12/24/nissan-initiates-multi-vehicle-recall-over-faulty-bolts/http://www.autoblog.com/2011/12/24/nissan-initiates-multi-vehicle-recall-over-faulty-bolts/#commentsFiled under: , , , , , , , ,



Nissan is recalling just over 14,700 vehicles from the 2011 and 2012 model years over faulty bolts in the engine. According to the National Highway Traffic Safety Administration, "bolts that connect the engine oil cooler and the engine oil filter to the engine in these vehicles may have been manufactured to below specification strength."

Affected Nissan vehicles include the 2011-12 Pathfinder, 2011-12 Xterra, 2012 NV and 2012 Frontier. Additionally, the 2011 Infiniti FX and 2012 Infiniti M are being recalled for this issue.

The NHTSA report states that if there is an engine oil leak, pressure would drop and the engine could possibly seize. Bad news all around.

The recall is expected to kick off in mid-January, and Nissan dealers will replace the connector bolts free of charge. To read the full NHTSA report, follow the jump.

Continue reading Nissan initiates multi-vehicle recall over faulty bolts

Nissan initiates multi-vehicle recall over faulty bolts originally appeared on Autoblog on Sat, 24 Dec 2011 17:02:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>frontierfxinfinitimnissannvpathfinderrecallsafetyxterraSat, 24 Dec 2011 17:02:00 EST http://www.autoblog.com/feed/20134101/article-comments.xml http://www.autoblog.com/feed/2011/12/24/nissan-initiates-multi-vehicle-recall-over-faulty-bolts/20134101/article-detail.xml 20134101 http://www.blogcdn.com/www.autoblog.com/media/2011/12/01-nissan-infiniti-recall628_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/12/01-nissan-infiniti-recall628.jpg <![CDATA[Nissan Frontier and Titan dash in with new appearance packages for 2012]]>http://www.autoblog.com/2011/10/03/nissan-frontier-and-titan-dash-in-with-new-appearance-packages-f/http://www.autoblog.com/2011/10/03/nissan-frontier-and-titan-dash-in-with-new-appearance-packages-f/http://www.autoblog.com/2011/10/03/nissan-frontier-and-titan-dash-in-with-new-appearance-packages-f/#commentsFiled under: , ,

2012 Nissan Frontier with Sport Appearance Package

2012 Nissan Titan with Sport Appearance PackageNissan has announced new appearance packages for the 2012 Frontier and Titan. The smaller of the two workhorses will jump into the new model year with a Sport Appearance Package on King Cab and Crew Cab SV iterations. The kit packs 18-inch aluminum alloy wheels, as well as a front grille with a Dark Hyper Silver, body-color front and rear bumpers and the Frontier graphic on the vehicle's flanks seen above. The interior gets its fair share of kit as well, with the addition of cloth sport seats, white-faced gauges and a Bluetooth hands-free calling system.

Meanwhile, the full-size Titan will receive a Sport Appearance Package of its own, complete with 20-inch aluminum alloy wheels, a grille dipped in the same finish as the aforementioned Frontier, body-color bumpers all around and a set of black step rails. A handy lockable storage compartment resides inside the bed, and Titan graphics are also part of the party. Inside, the appearance package brings along many of the same tricks as found in the Frontier with captain's chairs embroidered with the Titan logo and white-face gauges.

If you like the sound of this dance, you can expect to pay $1,190 for the Sport Appearance Package on the Frontier and $2,490 for the garb on the Titan. Hit the jump for the press releases.

Continue reading Nissan Frontier and Titan dash in with new appearance packages for 2012

Nissan Frontier and Titan dash in with new appearance packages for 2012 originally appeared on Autoblog on Mon, 03 Oct 2011 13:30:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2012 nissan frontier2012 nissan titanfrontiernissannissan frontiernissan frontier sport appearance packagenissan titannissan titan sport appearance packagesport appearance packagetitanMon, 03 Oct 2011 13:30:00 EST http://www.autoblog.com/feed/20072172/article-comments.xml http://www.autoblog.com/feed/2011/10/03/nissan-frontier-and-titan-dash-in-with-new-appearance-packages-f/20072172/article-detail.xml 20072172 http://www.blogcdn.com/www.autoblog.com/media/2011/10/2012-nissan-frontier-sport-pkg_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/10/2012-nissan-frontier-sport-pkg.jpg <![CDATA[Nissan SUV and pickup owners experiencing transmission failures]]>http://www.autoblog.com/2011/08/25/nissan-suv-and-pickup-owners-experiencing-transmission-failures/http://www.autoblog.com/2011/08/25/nissan-suv-and-pickup-owners-experiencing-transmission-failures/http://www.autoblog.com/2011/08/25/nissan-suv-and-pickup-owners-experiencing-transmission-failures/#commentsFiled under: , , , ,

2011 Nissan Pathfinder at sunset

Nissan is facing a rash of complaints about automatic transmission failures in the company's trucks and SUVs, according to The New York Times. Certain 2005-2010 Frontier, Pathfinder and Xterra models may have an issue with their radiators which could cause coolant to mix with the automatic transmission fluid. That's not supposed to happen, and it could cause premature failure. Nissan, meanwhile, has extended its warranty coverage on the radiators and any component damaged as a result of the fault, though owners say that they've been stuck with expensive transmission repair bills after the extended warranty dries up. The new coverage extends to 80,000 miles.

The NYT reports that Nissan extended its radiator coverage in October of last year after the company discovered that internal oil cooler tubes may crack and leak. The Automatic Transmission Rebuilders Association, meanwhile, says that the radiator coolant tanks themselves are rupturing, which then allows the fluid to mix with coolant before being pumped back into the transmission.

The National Highway Traffic Safety Administration has received upwards of 200 complaints on the issue, though it's still unclear at this point whether or not the government agency is looking into the problem. For its part, Nissan has said that if the problem occurs on vehicles still within the 80,000 mile radiator warranty, any transmission repairs would also be included in the coverage.

Nissan SUV and pickup owners experiencing transmission failures originally appeared on Autoblog on Thu, 25 Aug 2011 18:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>frontiernational highway traffic safety administrationnhtsanissannissan frontiernissan pathfindernissan transmissionnissan transmission problemnissan xterrapathfinderxterraThu, 25 Aug 2011 18:00:00 EST http://www.autoblog.com/feed/20026963/article-comments.xml http://www.autoblog.com/feed/2011/08/25/nissan-suv-and-pickup-owners-experiencing-transmission-failures/20026963/article-detail.xml 20026963 http://www.blogcdn.com/www.autoblog.com/media/2011/05/2011-nissan-pathfinder-review_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/05/2011-nissan-pathfinder-review.jpg <![CDATA[Nissan Frontier hits 1,000,000 units]]>http://www.autoblog.com/2011/06/08/nissan-frontier-hits-1-000-000-units/http://www.autoblog.com/2011/06/08/nissan-frontier-hits-1-000-000-units/http://www.autoblog.com/2011/06/08/nissan-frontier-hits-1-000-000-units/#commentsFiled under: , ,

2009 Nissan Frontier
2009 Nissan Frontier - Click above for high-res image gallery

Nissan has officially cranked out 1 million of the company's Frontier pickup trucks. By the time the first truck to bear the Frontier name rolled off of the line in 1997 as a 1998 model, Nissan had already established itself as a purveyor of fiendishly tough, inexpensive midsized pickups. According to PickupTrucks.com, the Japanese automaker first got into the American truck market back in 1959 when the Datsun 1000 landed on our shores. But it wasn't until the Datsun 520 showed up six years later that sales began to really take off.

Nissan became the first Japanese automaker to manufacture pickups in the U.S. in 1983 when the company began producing vehicles at its Smyrna, Tennessee plant. The move avoided a 25-percent tariff on foreign-built pickups, and since then, Nissan has built more than 2 million small trucks at the facility.

PickupTrucks.com reports that Nissan is working hard at the next-generation Frontier, but the model is facing poor sales at the moment. Last year, the automaker managed to sell just under 40,500 units - less than half of the 100,000 Hardbody pickups Nissan sold in 1987. Head over to PickupTrucks.com for an excellent rundown of the history of Nissan trucks in America.

Nissan Frontier hits 1,000,000 units originally appeared on Autoblog on Wed, 08 Jun 2011 09:00:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>frontiernissannissan frontiernissan trucksmyrnasmyrna tennesseeWed, 08 Jun 2011 09:00:00 EST http://www.autoblog.com/feed/19960905/article-comments.xml http://www.autoblog.com/feed/2011/06/08/nissan-frontier-hits-1-000-000-units/19960905/article-detail.xml 19960905 http://www.blogcdn.com/www.autoblog.com/media/2011/06/nissan-frontier-lead_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2011/06/nissan-frontier-lead.jpg <![CDATA[Nissan recalling 605,000 Frontier, Xterra and Sentra models over two issues]]>http://www.autoblog.com/2010/11/12/nissan-recalling-605-000-frontier-xterra-and-sentra-models-over/http://www.autoblog.com/2010/11/12/nissan-recalling-605-000-frontier-xterra-and-sentra-models-over/http://www.autoblog.com/2010/11/12/nissan-recalling-605-000-frontier-xterra-and-sentra-models-over/#commentsFiled under: , , , , ,

2002 Nissan Frontier

Nissan XterraNissan has issued a voluntary recall on select Frontier and Xterra models due to problems with the lower steering column joint and shaft, as well as the Sentra sedan for problems with the positive battery cable terminal. Just under 605,000 vehicles are affected by this recall, which is set to ramp up in early December.

Approximately 303,000 Frontiers and 283,000 Xterras in the United States, Canada and a number of Latin American countries can develop corrosion that limits the movement of the lower steering column joint. If this issue is overlooked, it can lead to the steering shaft cracking.

Sentras, on the other hand, have developed a problem with the connector on the positive battery cable terminal, which can cause the car to have issues starting, or can possibly result in stalling at low speeds. Approximately 18,500 Sentras manufactured between May 15, 2010 and July 8, 2010 are being recalled for this reason.

Affected model years depend on where the vehicle was manufactured, and you can see the full details in Nissan's press release, after the jump. Thanks to all for the tips!

[Sources: Nissan, CNN Money]

Continue reading Nissan recalling 605,000 Frontier, Xterra and Sentra models over two issues

Nissan recalling 605,000 Frontier, Xterra and Sentra models over two issues originally appeared on Autoblog on Fri, 12 Nov 2010 14:32:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>frontiernissannissan frontiernissan recallnissan sentranissan xterrarecallsafetysentraxterraFri, 12 Nov 2010 14:32:00 EST http://www.autoblog.com/feed/19713684/article-comments.xml http://www.autoblog.com/feed/2010/11/12/nissan-recalling-605-000-frontier-xterra-and-sentra-models-over/19713684/article-detail.xml 19713684 http://www.blogcdn.com/www.autoblog.com/media/2010/11/frontieropensky01_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2010/11/frontieropensky01.jpg <![CDATA[Nissan gets in on the custom graphics racket]]>http://www.autoblog.com/2010/10/06/nissan-gets-in-on-the-custom-graphics-racket/http://www.autoblog.com/2010/10/06/nissan-gets-in-on-the-custom-graphics-racket/http://www.autoblog.com/2010/10/06/nissan-gets-in-on-the-custom-graphics-racket/#commentsFiled under: , ,

Nissan Graphics - Nissan Cube
Nissan Graphics Custom Vinyl Wraps - Click above for high-res image gallery

Nissan is teaming up with Original Wraps Inc. to join Ford by jumping on the custom vinyl bandwagon. The Cube is the first Nissan to receive the vinyl wrap treatment and you can customize your own designs at NissanGraphics.com.

As the Cube customization hits the web it will quickly be followed by the Juke before Nissan moves on to the Frontier, with more products being added to the line over time. The graphics are installed by a professional, but can be removed at anytime and leave no residue. Manufacturing, warranties and shipping of the vinyl units are all handled by Original Wraps and each piece is designed to last up to three years. Hit the jump for the full details.


Gallery: Nissan Graphics Custom Wraps

Nissan Graphics Custom Wraps - Nissan CubeNissan Graphics Custom Wraps - Nissan CubeNissan Graphics Custom Wraps - Nissan CubeNissan Graphics Custom Wraps - Nissan Juke

[Source: Original Wraps]

Continue reading Nissan gets in on the custom graphics racket

Nissan gets in on the custom graphics racket originally appeared on Autoblog on Wed, 06 Oct 2010 17:32:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>cubecustomizationFrontiergraphicsjukenissannissan cubeNissan Frontiernissan graphicsnissan jukenissangraphicsoriginal wrapsvinylvinyl wrapWed, 06 Oct 2010 17:32:00 EST http://www.autoblog.com/feed/19662112/article-comments.xml http://www.autoblog.com/feed/2010/10/06/nissan-gets-in-on-the-custom-graphics-racket/19662112/article-detail.xml 19662112 http://www.blogcdn.com/www.autoblog.com/media/2010/10/nissan-graphics00_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2010/10/nissan-graphics00.jpg <![CDATA[Nissan joins overheating Garmin sat-nav recall]]>http://www.autoblog.com/2010/09/13/nissan-joins-overheating-garmin-sat-nav-recall/http://www.autoblog.com/2010/09/13/nissan-joins-overheating-garmin-sat-nav-recall/http://www.autoblog.com/2010/09/13/nissan-joins-overheating-garmin-sat-nav-recall/#commentsFiled under: , , ,

2010 Nissan Versa Hatchback
2010 Nissan Versa Hatchback - Click above for high-res image gallery

Nissan is recalling a number of models due to overheating Garmin navigation units. Cars, trucks and SUVs equipped with Nuvi 750, 760 and 765 GPS devices are at risk for a vehicle fire due to overheating batteries in the devices. According to the National Highway Traffic Safety Administration, the recall affects Nissan's Altima, Frontier, Pathfinder, Rogue, Sentra, Versa and Xterra models sold with the Garmin devices between 2008 and 2010. NHTSA does not say exactly how many vehicles will be effected by the defective batteries.

Garmin technicians will make the necessary repairs to the GPS units by replacing the battery with a new, less-toasty unit and adding an additional spacer between the battery and the rest of the device. The repair won't cost owners anything other than a little time and a trip to the local dealership. Nissan will notify owners directly about the recall, which is scheduled to begin sometime during this month. Suzuki is facing a similar recall, as well - these Garmin navigation units are fitted in the SX4, Grand Vitara and Equator.


Gallery: Review: 2010 Nissan Versa Hatchback


Photos Copyright (C)2010 Steven J. Ewing / AOL

[Source: NHTSA]

Nissan joins overheating Garmin sat-nav recall originally appeared on Autoblog on Mon, 13 Sep 2010 14:29:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>altimafrontiergarmingarmin nuvigarmin recallnational highway traffic safety administrationnhtsanissannissan altimanissan frontiernissan pathfindernissan roguenissan sentranissan versanissan xterranuvi recallpathfinderroguesentraversaxterraMon, 13 Sep 2010 14:29:00 EST http://www.autoblog.com/feed/19631432/article-comments.xml http://www.autoblog.com/feed/2010/09/13/nissan-joins-overheating-garmin-sat-nav-recall/19631432/article-detail.xml 19631432 http://www.blogcdn.com/www.autoblog.com/media/2010/09/01nissanversahatchreview2010_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2010/09/01nissanversahatchreview2010.jpg <![CDATA[2011 Nissan Xterra, Pathfinder, Frontier and Altima pricing announced]]>http://www.autoblog.com/2010/09/11/2011-nissan-xterra-pathfinder-frontier-and-altima-pricing-anno/http://www.autoblog.com/2010/09/11/2011-nissan-xterra-pathfinder-frontier-and-altima-pricing-anno/http://www.autoblog.com/2010/09/11/2011-nissan-xterra-pathfinder-frontier-and-altima-pricing-anno/#commentsFiled under: , , , ,

2011 Nissan Xterra
2011 Nissan Xterra - Click above for high-res image gallery

You can quit biting your nails waiting for Nissan to unveil pricing information on the 2011 Pathfinder, Xterra, Frontier and Altima. The company has just announced that, starting next year, the Pathfinder will start at $27,840 for the two-wheel drive, V6 S model. That marks a $300 increase over the 2010 version. Topped out, the SUV will set you back $42,600 for the four-wheel drive V8 LE.

Meanwhile, the base, two-wheel drive Xterra X commands an MSRP of $23,850, which is about $1,100 more than the outgoing model. Option up to the range-topping four-wheel drive PRO-4X with an automatic gearbox, and you can expect to hand over $30,100 of your hard-earned cash.

If a pickup is more your flavor, Nissan will let you hop into a Frontier S King Cab two-wheel drive for $17,750, though the topped-out SL Crew Cab with four-wheel drive, long-wheelbase chassis and a V6 engine coupled to a five-speed automatic gearbox will cost significantly more at $31,630.

Finally, the company has priced the 2011 Nissan Altima sedan at $19,900 when equipped with a 2.5-liter four-cylinder engine and a CVT gearbox. Look to pay $22,940 for the Altima Coupe and $26,780 for the hybrid sedan.

None of the prices above include destination, so you can expect things to be just a bit more expensive by the time you leave the dealer lot with keys in hand. Hit the jump for the full press release.


Gallery: 2011 Nissan Xterra


[Source: Nissan]

Continue reading 2011 Nissan Xterra, Pathfinder, Frontier and Altima pricing announced

2011 Nissan Xterra, Pathfinder, Frontier and Altima pricing announced originally appeared on Autoblog on Sat, 11 Sep 2010 19:07:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>20112011 Frontier2011 Nissan Frontier2011 Nissan Pathfinder2011 Nissan Xterra2011 Pathfinder2011 Xterra2011Frontier2011NissanFrontier2011NissanPathfinder2011NissanXterra2011Pathfinder2011XterraFrontierNissanNissan XterraNissanXterraPathfinderXterraSat, 11 Sep 2010 19:07:00 EST http://www.autoblog.com/feed/19628747/article-comments.xml http://www.autoblog.com/feed/2010/09/11/2011-nissan-xterra-pathfinder-frontier-and-altima-pricing-anno/19628747/article-detail.xml 19628747 http://www.blogcdn.com/www.autoblog.com/media/2010/09/xterra-630_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2010/09/xterra-630.jpg <![CDATA[Report: Nissan Titan and Frontier pickups to get new model designations for 2011, little else]]>http://www.autoblog.com/2010/06/30/report-nissan-titan-and-frontier-pickups-to-get-new-model-desig/http://www.autoblog.com/2010/06/30/report-nissan-titan-and-frontier-pickups-to-get-new-model-desig/http://www.autoblog.com/2010/06/30/report-nissan-titan-and-frontier-pickups-to-get-new-model-desig/#commentsFiled under: ,



While Nissan refines its pickup truck plans and gets ready for an all new Titan in 2014, it is doing only a little bit of tweaking to the 2011 Titan and Frontier. The Titan swaps three of its four trim level names, with XE becoming S, SE becoming SV and LE becoming SL, and any four-wheel drive model will get a "4x4" badge. More substantively, captain's chairs will be fitted as standard on the top-level SL trim. The 317-horsepower, 5.6 liter V8 remains unchanged.

The name swap carries over to the Frontier, however, with the PRO-4X model keeping its name on the Frontier and Titan. The smaller pickup loses the six-speed manual on the long wheelbase SL King Cab and SV Crew Cab, but gains a six-speed manual option for the lowest trim S model and the PRO-4X short wheelbases. The top line SV trim adds a Luxury Package to its option sheet, and with a little mix-n-match you can get LATCH child safety seats.

The 2011 Titan goes on sale in August, the V6 Frontiers hit showrooms in September, the four cylinder Frontiers in October.

[Source: PickupTrucks.com]

Report: Nissan Titan and Frontier pickups to get new model designations for 2011, little else originally appeared on Autoblog on Wed, 30 Jun 2010 09:28:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>20112011 frontier2011 nissan2011 nissan frontier2011 nissan titan2011 titan2011Frontier2011Nissan2011NissanFrontier2011NissanTitan2011Titanfrontiernissan frontiernissan titanNissanFrontierNissanTitantitanWed, 30 Jun 2010 09:28:00 EST http://www.autoblog.com/feed/19532860/article-comments.xml http://www.autoblog.com/feed/2010/06/30/report-nissan-titan-and-frontier-pickups-to-get-new-model-desig/19532860/article-detail.xml 19532860 http://www.blogcdn.com/www.autoblog.com/media/2010/06/nissan11titan_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2010/06/nissan11titan.jpg <![CDATA[Nissan Frontier tops latest round of IIHS crash tests, Chevrolet Colorado hits bottom]]>http://www.autoblog.com/2010/02/04/nissan-frontier-tops-latest-round-of-iihs-crash-tests-chevrolet/http://www.autoblog.com/2010/02/04/nissan-frontier-tops-latest-round-of-iihs-crash-tests-chevrolet/http://www.autoblog.com/2010/02/04/nissan-frontier-tops-latest-round-of-iihs-crash-tests-chevrolet/#commentsFiled under: , , , , , , , ,

IIHS compact pickup crash tests - Click above for high-res image gallery

The Insurance Institute for Highway Safety has tested five compact pickup trucks for both rollover and side impact crashes, and overall, it would seem that the trucks' performances were pretty dismal. Only the Nissan Frontier was given a 'Good' rating from the IIHS for rollover protection, with the Ford Ranger falling to second place with an 'Acceptable' rating and the Chevrolet Colorado, Dodge Dakota and Toyota Tacoma earning lowly 'Marginal' scores.

Side impact scores also failed to live up to expectations for some trucks, with the Frontier, Ranger and Tacoma getting 'Good' ratings and the Colorado getting the lowest 'Poor' rating. Equally as disturbing, though, was the performance of the Dakota, which was tested with optional side air bags (all the other trucks come standard with the bags) that failed to deploy in IIHS testing. Chrysler has reportedly identified the software glitch that caused the air bags not to deploy and is working on a fix. The Dakota will be retested with properly functional air bags at a later date.

See the results of the testing in our image gallery below and click past the break for the official press release from the IIHS.


Gallery: IIHS Compact Pickup Tests


[Source: The Insurance Institute for Highway Safety]

Continue reading Nissan Frontier tops latest round of IIHS crash tests, Chevrolet Colorado hits bottom

Nissan Frontier tops latest round of IIHS crash tests, Chevrolet Colorado hits bottom originally appeared on Autoblog on Thu, 04 Feb 2010 15:29:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>chevrolet coloradoChevroletColoradochevychevy coloradoChevyColoradocoloradocompact pickupcompact pickup crash testcompact truckcompact truck crash testCompactPickupCompactPickupCrashTestCompactTruckCompactTruckCrashTestford rangerFordRangerfrontieriihsiihs compact pickupsiihs compact trucksIihsCompactPickupsIihsCompactTrucksInsurance Institute for Highway SafetyInsuranceInstituteForHighwaySafetyNissan frontierNissanFrontierrangerrolloverrollover protectionrollover testRolloverProtectionRolloverTesttacomatoyota tacomaToyotaTacomaThu, 04 Feb 2010 15:29:00 EST http://www.autoblog.com/feed/19345170/article-comments.xml http://www.autoblog.com/feed/2010/02/04/nissan-frontier-tops-latest-round-of-iihs-crash-tests-chevrolet/19345170/article-detail.xml 19345170 http://www.blogcdn.com/www.autoblog.com/media/2010/02/colorado-roof_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2010/02/colorado-roof.jpg <![CDATA[Review: 2009 Nissan Frontier continues to blaze the small truck trail]]>http://www.autoblog.com/2009/07/20/review-2009-nissan-frontier-continues-to-blaze-the-small-truck/http://www.autoblog.com/2009/07/20/review-2009-nissan-frontier-continues-to-blaze-the-small-truck/http://www.autoblog.com/2009/07/20/review-2009-nissan-frontier-continues-to-blaze-the-small-truck/#commentsFiled under: , , , ,


2009 Nissan Frontier - Click above for high-res image gallery

Small pickups occupy an odd and oft forgotten spot in the over-hyped, Biggie-Sized truck segment, but making a case for their existence remains easy. Not everyone needs a larger vehicle or has the space for a full-size truck, and small pickups offer the utility weekend warriors require without necessitating an organ exchange at the pump. Although not as diminutive as their forebears, today's more compact dimensions are easier to cope with behind the wheel, and in this economy, moving down a rung in the pickup hierarchy is sure to save you a few dollars in monthly payments and insurance premiums. But is it just about a small footprint and an easy to swallow sticker? Or is just best to bite the bullet and option up for what some consider to be a "real" pickup? We test the 2009 Nissan Frontier to see if this squat truck has more than just measurements on its size to woo punch-drunk pickup buyers away from the latest and greatest in the full-size segment.


Gallery: Review: 2009 Nissan Frontier


Photos Copyright (C)2009 Dan Roth / Weblogs, Inc.

Continue reading Review: 2009 Nissan Frontier continues to blaze the small truck trail

Review: 2009 Nissan Frontier continues to blaze the small truck trail originally appeared on Autoblog on Mon, 20 Jul 2009 11:55:00 EST. Please see our terms for use of feeds.

Permalink | Email this | Comments]]>2009 nissan frontier2009NissanFrontierfeaturedfrontiernissannissan frontierNissanFrontierreviewreviewsMon, 20 Jul 2009 11:55:00 EST http://www.autoblog.com/feed/19103411/article-comments.xml http://www.autoblog.com/feed/2009/07/20/review-2009-nissan-frontier-continues-to-blaze-the-small-truck/19103411/article-detail.xml 19103411 http://www.blogcdn.com/www.autoblog.com/media/2009/07/frontier_review000_opt_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2009/07/frontier_review000_opt.jpg <![CDATA[Nissan recalls nearly 250,000 Xterras, Pathfinders and Frontiers]]>http://www.autoblog.com/2009/01/07/nissan-recalls-nearly-250-000-xterras-pathfinders-and-frontier/http://www.autoblog.com/2009/01/07/nissan-recalls-nearly-250-000-xterras-pathfinders-and-frontier/http://www.autoblog.com/2009/01/07/nissan-recalls-nearly-250-000-xterras-pathfinders-and-frontier/#commentsFiled under: , ,



Nissan is recalling 242,720 model years 2005-2009 Xterras, Pathfinders, and Frontiers for faulty Crash Zone Sensors (front) that may prevent front airbags from deploying in an accident. The recall is Nissan's second airbag sensor-related issue in the past three months. The last recall involved passenger cars including the Altima. This particular recall mainly effects vehicles sold in the northern half of the U.S. where heavy salt usage during winter months can corrode the crash sensor. The corrosion can then cause sensor interruption, which will cause the air bag warning light to illuminate.

To fix the problem, Nissan will replace the faulty sensors with an improved sensor. Owners of 2005-2009 Xterras, Pathfinders and Frontiers that live outside of the States where the recall is in effect will receive a 10-year extended warranty on the Crash Zone Sensors. Nissan hasn't yet set a timetable for the recall, but if your air bag warning illuminates, we'd suggest heading to your neighborhood Nissan dealer right away to get it fixed. Hit the jump to see if you live in one of the states affected by the recall. Thanks for the tip, Owen!

[Source: NHTSA]

Continue reading Nissan recalls nearly 250,000 Xterras, Pathfinders and Frontiers

Nissan recalls nearly 250,000 Xterras, Pathfinders and Frontiers originally appeared on Autoblog on Wed, 07 Jan 2009 07:58:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>airbag sensorAirbagSensorfrontierNHTSANissanPathfinderrecallXterraWed, 07 Jan 2009 07:58:00 EST http://www.autoblog.com/feed/1420741/article-comments.xml http://www.autoblog.com/feed/2009/01/07/nissan-recalls-nearly-250-000-xterras-pathfinders-and-frontier/1420741/article-detail.xml 1420741 http://www.blogcdn.com/www.autoblog.com/media/2009/01/my09xterra_202_opt_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2009/01/my09xterra_202_opt.jpg <![CDATA[Nissan announces pricing on 2007 trucks and SUVs]]>http://www.autoblog.com/2006/09/06/nissan-announces-pricing-on-2007-trucks-and-suvs/http://www.autoblog.com/2006/09/06/nissan-announces-pricing-on-2007-trucks-and-suvs/http://www.autoblog.com/2006/09/06/nissan-announces-pricing-on-2007-trucks-and-suvs/#commentsFiled under: ,



Another year is approaching and, on its impending arrival, Nissan released new figures for its current lineup of pickups and sport utility vehicles.

But before we douse you with the bloated figures that make up anything with optional four-wheel drive, a note about the Versa. Nissan's fuel-miser will get an additional $100 stuck onto its sticker price, due to, well, we don't know why, just because. The 1.8-liter, six-speed equipped "S" model will come in at $12,550, with an automatic tranny setting you back an additional $800. The SL model with a stick comes in at $13,350, while the automatic will have an MSRP of $14,550. Add a CVT to the mix and tack on another grand.

Now, onto the big boys.

Continue reading Nissan announces pricing on 2007 trucks and SUVs

Nissan announces pricing on 2007 trucks and SUVs originally appeared on Autoblog on Wed, 06 Sep 2006 09:59:00 EST. Please see our terms for use of feeds.

Read | Permalink | Email this | Comments]]>armadafrontiermuranonissanpathfindertitanversaxterraWed, 06 Sep 2006 09:59:00 EST http://www.autoblog.com/feed/664466/article-comments.xml http://www.autoblog.com/feed/2006/09/06/nissan-announces-pricing-on-2007-trucks-and-suvs/664466/article-detail.xml 664466 http://www.blogcdn.com/www.autoblog.com/media/2006/09/nissan_armada_pricing_thumbnail.jpg http://www.blogcdn.com/www.autoblog.com/media/2006/09/nissan_armada_pricing.jpg -1 2